GML (glycosylphosphatidylinositol anchored molecule like)

Gene Gene information from NCBI Gene database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID 2765
Gene name Glycosylphosphatidylinositol anchored molecule like
Gene symbol GML
Synonyms (NCBI Gene)
LY6DL
Chromosome 8
Chromosome location 8q24.3
Transcription factors Transcription factors information provided by TRRUST V2 database.
1
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (1)
Transcription factor Regulation Reference
TP53 Activation 10717525
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Show/Hide all (8)
GO ID Ontology Definition Evidence Reference
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS 8934543
GO:0006915 Process Apoptotic process TAS 8934543
GO:0008285 Process Negative regulation of cell population proliferation TAS 8934543
GO:0016020 Component Membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
602370 4375 ENSG00000104499
Protein Protein information from UniProt database.
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99445
Protein name Glycosyl-phosphatidylinositol-anchored molecule-like protein
Protein function May play a role in the apoptotic pathway or cell-cycle regulation induced by p53/TP53 after DNA damage.
Family and domains
Sequence 
MLLFALLLAMELPLVAASATMRAQWTYSLRCHDCAVINDFNCPNIRVCPYHIRRCMTISI
RINSRELLVYKNCTNNCTFVYAAEQPPEAPGKIFKTNSFYWVCCCNSMVCNAGGPTNLER
DMLPDEVTEEELPEGTVRLGVSKLLLSFASIIVSNILP
Sequence length 158
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
7
Gene Transcription factors Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (7)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Autism Likely benign ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER — Disgenet
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HYPERTENSION — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (19)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 286631
★★★★★
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases GWASCAT_DG 30595370
★★★★★
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 11706756
★★★★★
★☆☆☆☆
Found in Text Mining only
Congenital adrenal hyperplasia Congenital adrenal hyperplasia CLINVAR_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Congenital adrenal hyperplasia due to 11-Beta-hydroxylase deficiency Congenital adrenal hyperplasia CLINVAR_DG 10487675, 15751602, 15755848, 15807871, 16046588, 16670167, 17371482, 17726333, 18663314, 20089618, 2022736, 22964742, 23940125, 24022297, 24334966
View all (15 more)
★★★★★
★☆☆☆☆
Found in Text Mining only
Corticosterone Methyl Oxidase Type I Deficiency Corticosterone Methyl Oxidase Deficiency CLINVAR_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Corticosterone Methyl Oxidase Type II Deficiency Corticosterone Methyl Oxidase Deficiency CLINVAR_DG
★★★★★
★☆☆☆☆
Found in Text Mining only
Esophageal carcinoma Esophageal Carcinoma BEFREE 8934543, 9425296
★★★★★
★☆☆☆☆
Found in Text Mining only
Esophageal Neoplasms Esophagus Neoplasm BEFREE 8934543, 9425296
★★★★★
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 10527072
★★★★★
★☆☆☆☆
Found in Text Mining only