Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2762
Gene name	GDP-mannose 4,6-dehydratase
Gene symbol	GMDS
Synonyms (NCBI Gene)	GMDSDR3E1
Chromosome	6
Chromosome location	6p25.3
Summary	GDP-mannose 4,6-dehydratase (GMD; EC 4.2.1.47) catalyzes the conversion of GDP-mannose to GDP-4-keto-6-deoxymannose, the first step in the synthesis of GDP-fucose from GDP-mannose, using NADP+ as a cofactor. The second and third steps of the pathway are c

116

Show/Hide all (116)

miRTarBase ID	miRNA	Experiments	Reference
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT526051	hsa-miR-4803	PAR-CLIP	22012620
MIRT526050	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT526049	hsa-miR-3622a-5p	PAR-CLIP	22012620
MIRT526048	hsa-miR-654-3p	PAR-CLIP	22012620
MIRT526047	hsa-miR-3128	PAR-CLIP	22012620
MIRT526046	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT526045	hsa-miR-4720-5p	PAR-CLIP	22012620
MIRT526044	hsa-miR-4799-3p	PAR-CLIP	22012620
MIRT526043	hsa-miR-5588-5p	PAR-CLIP	22012620
MIRT526042	hsa-miR-3622b-5p	PAR-CLIP	22012620
MIRT526041	hsa-miR-496	PAR-CLIP	22012620
MIRT526040	hsa-miR-3143	PAR-CLIP	22012620
MIRT526039	hsa-miR-4423-3p	PAR-CLIP	22012620
MIRT526038	hsa-miR-1231	PAR-CLIP	22012620
MIRT526037	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT440560	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440560	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT712759	hsa-miR-3150a-5p	HITS-CLIP	19536157
MIRT712758	hsa-miR-3150b-5p	HITS-CLIP	19536157
MIRT712756	hsa-miR-6812-3p	HITS-CLIP	19536157
MIRT712757	hsa-miR-1307-3p	HITS-CLIP	19536157
MIRT712755	hsa-miR-744-5p	HITS-CLIP	19536157
MIRT712754	hsa-miR-1908-5p	HITS-CLIP	19536157
MIRT712753	hsa-miR-663a	HITS-CLIP	19536157
MIRT712751	hsa-miR-6787-5p	HITS-CLIP	19536157
MIRT712752	hsa-miR-3180	HITS-CLIP	19536157
MIRT712750	hsa-miR-3180-3p	HITS-CLIP	19536157
MIRT712748	hsa-miR-3196	HITS-CLIP	19536157
MIRT712749	hsa-miR-6816-5p	HITS-CLIP	19536157
MIRT526051	hsa-miR-4803	PAR-CLIP	22012620
MIRT526050	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT526049	hsa-miR-3622a-5p	PAR-CLIP	22012620
MIRT526048	hsa-miR-654-3p	PAR-CLIP	22012620
MIRT526047	hsa-miR-3128	PAR-CLIP	22012620
MIRT526046	hsa-miR-6868-5p	PAR-CLIP	22012620
MIRT526045	hsa-miR-4720-5p	PAR-CLIP	22012620
MIRT526044	hsa-miR-4799-3p	PAR-CLIP	22012620
MIRT526043	hsa-miR-5588-5p	PAR-CLIP	22012620
MIRT526042	hsa-miR-3622b-5p	PAR-CLIP	22012620
MIRT526041	hsa-miR-496	PAR-CLIP	22012620
MIRT526040	hsa-miR-3143	PAR-CLIP	22012620
MIRT526039	hsa-miR-4423-3p	PAR-CLIP	22012620
MIRT526038	hsa-miR-1231	PAR-CLIP	22012620
MIRT526037	hsa-miR-302c-5p	PAR-CLIP	22012620
MIRT1022450	hsa-miR-1909	CLIP-seq
MIRT1022451	hsa-miR-214	CLIP-seq
MIRT1022452	hsa-miR-3197	CLIP-seq
MIRT1022453	hsa-miR-3619-5p	CLIP-seq
MIRT1022454	hsa-miR-761	CLIP-seq
MIRT1022450	hsa-miR-1909	CLIP-seq
MIRT1022452	hsa-miR-3197	CLIP-seq
MIRT2236037	hsa-miR-4493	CLIP-seq
MIRT2236038	hsa-miR-4719	CLIP-seq
MIRT2236039	hsa-miR-4758-3p	CLIP-seq
MIRT2236040	hsa-miR-513b	CLIP-seq
MIRT2236041	hsa-miR-744	CLIP-seq

Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IC	9525924
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007219	Process	Notch signaling pathway	ISS
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IBA
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IDA	9525924
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IEA
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	IGI	9603974
GO:0008446	Function	GDP-mannose 4,6-dehydratase activity	TAS
GO:0016829	Function	Lyase activity	IEA
GO:0019673	Process	GDP-mannose metabolic process	IDA	9525924
GO:0019673	Process	GDP-mannose metabolic process	IEA
GO:0019673	Process	GDP-mannose metabolic process	IGI	9603974
GO:0042350	Process	GDP-L-fucose biosynthetic process	TAS
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IBA
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IDA	9525924
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IEA
GO:0042802	Function	Identical protein binding	IPI	16189514, 25416956, 31515488, 32296183
GO:0070062	Component	Extracellular exosome	HDA	19199708
GO:0070401	Function	NADP+ binding	IDA	9525924

MIM	HGNC	e!Ensembl
602884	4369	ENSG00000112699

O60547

Protein name

GDP-mannose 4,6 dehydratase (EC 4.2.1.47) (GDP-D-mannose dehydratase) (GMD)

Protein function

Catalyzes the conversion of GDP-D-mannose to GDP-4-dehydro-6-deoxy-D-mannose.

PDB

1T2A , 5IN4 , 5IN5 , 6GPJ , 6GPK , 6GPL , 6Q94

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16363	GDP_Man_Dehyd	27 → 358	GDP-mannose 4,6 dehydratase	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in pancreas and small intestine. Expressed in thymus, protstate, colon, heart, placenta, liver and kidney. Expressed at low levels in spleen, testis, brain and lung. {ECO:0000269|PubMed:9525924}.

Sequence

MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSF
NTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDL
AEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYG
AAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSL
GNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEG
KNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVH
ADVELMRTNPNA

Sequence length

372

Interactions

View interactions

	KEGG		Reactome
	Fructose and mannose metabolism Biosynthesis of various nucleotide sugars Metabolic pathways Biosynthesis of nucleotide sugars		GDP-fucose biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (24)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CLEAR CELL RENAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA, OPEN-ANGLE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET MYASTHENIA GRAVIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (21)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29843634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28795659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31423008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	26957041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19361506, 23922970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23922970, 27639802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23922970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	BEFREE	26957041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 2C	Congenital disorder of glycosylation	Pubtator	9662431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29417694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	37916327	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	25173105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	GWASCAT_DG	25173105, 29891935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	25173105, 27862086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	26957041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	30072579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31249452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19361506, 23922970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19361506, 23922970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19361506, 22027835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	29417694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

GMDS (GDP-mannose 4,6-dehydratase)