GLRX (glutaredoxin)

Gene

• Entrez ID: 2745
• Gene name: Glutaredoxin
• Gene symbol: GLRX
• Synonyms (NCBI Gene): GRX, GRX1
• Chromosome: 5
• Chromosome location: 5q15
• Summary: This gene encodes a member of the glutaredoxin family. The encoded protein is a cytoplasmic enzyme catalyzing the reversible reduction of glutathione-protein mixed disulfides. This enzyme highly contributes to the antioxidant defense system. It is crucial

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021981	hsa-miR-128-3p	Microarray	17612493
MIRT027076	hsa-miR-103a-3p	Sequencing	20371350
MIRT028491	hsa-miR-30a-5p	Proteomics	18668040
MIRT029425	hsa-miR-26b-5p	Microarray	19088304
MIRT031719	hsa-miR-16-5p	Sequencing	20371350
MIRT512810	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT512809	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT512808	hsa-miR-219a-1-3p	PAR-CLIP	23446348
MIRT512807	hsa-miR-4653-3p	PAR-CLIP	23446348
MIRT512806	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT512805	hsa-miR-342-5p	PAR-CLIP	23446348
MIRT512804	hsa-miR-4664-5p	PAR-CLIP	23446348
MIRT512803	hsa-miR-4651	PAR-CLIP	23446348
MIRT512802	hsa-miR-608	PAR-CLIP	23446348
MIRT512801	hsa-miR-6747-5p	PAR-CLIP	23446348
MIRT512800	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT512799	hsa-miR-6745	PAR-CLIP	23446348
MIRT512797	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT512798	hsa-miR-4654	PAR-CLIP	23446348
MIRT512796	hsa-miR-4769-5p	PAR-CLIP	23446348
MIRT512795	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT512794	hsa-miR-6737-5p	PAR-CLIP	23446348
MIRT512793	hsa-miR-6812-5p	PAR-CLIP	23446348
MIRT512792	hsa-miR-6819-5p	PAR-CLIP	23446348
MIRT512810	hsa-miR-6890-5p	PAR-CLIP	23446348
MIRT512809	hsa-miR-4761-5p	PAR-CLIP	23446348
MIRT512808	hsa-miR-219a-1-3p	PAR-CLIP	23446348
MIRT512807	hsa-miR-4653-3p	PAR-CLIP	23446348
MIRT512806	hsa-miR-5187-5p	PAR-CLIP	23446348
MIRT512805	hsa-miR-342-5p	PAR-CLIP	23446348
MIRT512804	hsa-miR-4664-5p	PAR-CLIP	23446348
MIRT512803	hsa-miR-4651	PAR-CLIP	23446348
MIRT512802	hsa-miR-608	PAR-CLIP	23446348
MIRT512801	hsa-miR-6747-5p	PAR-CLIP	23446348
MIRT512800	hsa-miR-363-5p	PAR-CLIP	23446348
MIRT512799	hsa-miR-6745	PAR-CLIP	23446348
MIRT512797	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT512798	hsa-miR-4654	PAR-CLIP	23446348
MIRT512796	hsa-miR-4769-5p	PAR-CLIP	23446348
MIRT512795	hsa-miR-6728-5p	PAR-CLIP	23446348
MIRT512794	hsa-miR-6737-5p	PAR-CLIP	23446348
MIRT512793	hsa-miR-6812-5p	PAR-CLIP	23446348
MIRT512792	hsa-miR-6819-5p	PAR-CLIP	23446348
MIRT1021436	hsa-miR-133a	CLIP-seq
MIRT1021437	hsa-miR-133b	CLIP-seq
MIRT1021438	hsa-miR-200b	CLIP-seq
MIRT1021439	hsa-miR-200c	CLIP-seq
MIRT1021440	hsa-miR-425	CLIP-seq
MIRT1021441	hsa-miR-429	CLIP-seq
MIRT1021442	hsa-miR-4436b-5p	CLIP-seq
MIRT1021443	hsa-miR-640	CLIP-seq
MIRT2235643	hsa-miR-1224-5p	CLIP-seq
MIRT2235644	hsa-miR-3126-3p	CLIP-seq
MIRT2235645	hsa-miR-3126-5p	CLIP-seq
MIRT2235646	hsa-miR-3150b-3p	CLIP-seq
MIRT2235647	hsa-miR-3675-5p	CLIP-seq
MIRT2235648	hsa-miR-3915	CLIP-seq
MIRT2235649	hsa-miR-4310	CLIP-seq
MIRT2235650	hsa-miR-4689	CLIP-seq
MIRT2235651	hsa-miR-4779	CLIP-seq
MIRT2235652	hsa-miR-4782-5p	CLIP-seq
MIRT2235653	hsa-miR-4784	CLIP-seq
MIRT2235654	hsa-miR-526b	CLIP-seq
MIRT2450373	hsa-miR-3659	CLIP-seq
MIRT2450374	hsa-miR-4797-5p	CLIP-seq
MIRT2450375	hsa-miR-759	CLIP-seq
MIRT2450373	hsa-miR-3659	CLIP-seq
MIRT2450374	hsa-miR-4797-5p	CLIP-seq
MIRT2450375	hsa-miR-759	CLIP-seq
MIRT2539559	hsa-miR-1252	CLIP-seq
MIRT2539560	hsa-miR-1914	CLIP-seq
MIRT2539561	hsa-miR-219-2-3p	CLIP-seq
MIRT2539562	hsa-miR-27a	CLIP-seq
MIRT2539563	hsa-miR-27b	CLIP-seq
MIRT2539564	hsa-miR-3140-3p	CLIP-seq
MIRT2539565	hsa-miR-337-3p	CLIP-seq
MIRT2450373	hsa-miR-3659	CLIP-seq
MIRT2539566	hsa-miR-3685	CLIP-seq
MIRT2539567	hsa-miR-384	CLIP-seq
MIRT2539568	hsa-miR-433	CLIP-seq
MIRT2539569	hsa-miR-4470	CLIP-seq
MIRT2539570	hsa-miR-4712-3p	CLIP-seq
MIRT2539571	hsa-miR-4742-5p	CLIP-seq
MIRT2539572	hsa-miR-4773	CLIP-seq
MIRT2539573	hsa-miR-4777-5p	CLIP-seq
MIRT2450374	hsa-miR-4797-5p	CLIP-seq
MIRT2539574	hsa-miR-513a-5p	CLIP-seq
MIRT2539575	hsa-miR-515-5p	CLIP-seq
MIRT2539576	hsa-miR-518d-5p	CLIP-seq
MIRT2539577	hsa-miR-519b-5p	CLIP-seq
MIRT2539578	hsa-miR-519c-5p	CLIP-seq
MIRT2539579	hsa-miR-520c-5p	CLIP-seq
MIRT2539580	hsa-miR-526a	CLIP-seq
MIRT2539581	hsa-miR-600	CLIP-seq
MIRT2539582	hsa-miR-653	CLIP-seq
MIRT2539583	hsa-miR-668	CLIP-seq
MIRT2450375	hsa-miR-759	CLIP-seq
MIRT2539559	hsa-miR-1252	CLIP-seq
MIRT2681650	hsa-miR-1305	CLIP-seq
MIRT2539560	hsa-miR-1914	CLIP-seq
MIRT2539561	hsa-miR-219-2-3p	CLIP-seq
MIRT2539562	hsa-miR-27a	CLIP-seq
MIRT2539563	hsa-miR-27b	CLIP-seq
MIRT2681651	hsa-miR-28-5p	CLIP-seq
MIRT2681652	hsa-miR-3139	CLIP-seq
MIRT2539564	hsa-miR-3140-3p	CLIP-seq
MIRT2681653	hsa-miR-3161	CLIP-seq
MIRT2539565	hsa-miR-337-3p	CLIP-seq
MIRT2539566	hsa-miR-3685	CLIP-seq
MIRT2539567	hsa-miR-384	CLIP-seq
MIRT2681654	hsa-miR-3973	CLIP-seq
MIRT2681655	hsa-miR-4280	CLIP-seq
MIRT2681656	hsa-miR-4320	CLIP-seq
MIRT2539568	hsa-miR-433	CLIP-seq
MIRT2539569	hsa-miR-4470	CLIP-seq
MIRT2681657	hsa-miR-4475	CLIP-seq
MIRT2539570	hsa-miR-4712-3p	CLIP-seq
MIRT2539571	hsa-miR-4742-5p	CLIP-seq
MIRT2539572	hsa-miR-4773	CLIP-seq
MIRT2539573	hsa-miR-4777-5p	CLIP-seq
MIRT2539574	hsa-miR-513a-5p	CLIP-seq
MIRT2539575	hsa-miR-515-5p	CLIP-seq
MIRT2539576	hsa-miR-518d-5p	CLIP-seq
MIRT2539577	hsa-miR-519b-5p	CLIP-seq
MIRT2539578	hsa-miR-519c-5p	CLIP-seq
MIRT2539579	hsa-miR-520c-5p	CLIP-seq
MIRT2681658	hsa-miR-520g	CLIP-seq
MIRT2681659	hsa-miR-520h	CLIP-seq
MIRT2539580	hsa-miR-526a	CLIP-seq
MIRT2539581	hsa-miR-600	CLIP-seq
MIRT2681660	hsa-miR-607	CLIP-seq
MIRT2539582	hsa-miR-653	CLIP-seq
MIRT2539583	hsa-miR-668	CLIP-seq
MIRT2681661	hsa-miR-708	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16884690, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	16884690
GO:0015036	Function	Disulfide oxidoreductase activity	IEA
GO:0015038	Function	Glutathione disulfide oxidoreductase activity	EXP	7851394
GO:0015038	Function	Glutathione disulfide oxidoreductase activity	IBA
GO:0015038	Function	Glutathione disulfide oxidoreductase activity	TAS	7851394, 19542013
GO:0015949	Process	Nucleobase-containing small molecule interconversion	TAS
GO:0017080	Function	Sodium channel regulator activity	IDA	19542013
GO:0045838	Process	Positive regulation of membrane potential	IDA	19542013
GO:0070062	Component	Extracellular exosome	HDA	18570454, 19199708

Other IDs

• MIM: 600443
• HGNC: 4330
• e!Ensembl: ENSG00000173221

Protein

• UniProt ID: P35754
• Protein name: Glutaredoxin-1 (Thioltransferase-1) (TTase-1)
• Protein function: Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.
• PDB: 1B4Q, 1JHB, 4RQR
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00462	Glutaredoxin	15 → 80	Glutaredoxin	Domain

• Sequence:

  MAQEFVNCKIQPGKVVVFIKPTCPYCRRAQEILSQLPIKQGLLEFVDITATNHTNEIQDY
  LQQLTGARTVPRVFIGKDCIGGCSDLVSLQQSGELLTRLKQIGALQ

• Sequence length: 106

Pathways

Reactome:

Interconversion of nucleotide di- and triphosphates

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30661098		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	16880213	Associate	★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29366902		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	36818541	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29138498		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29138498		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12532421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	26845626		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	35693421	Inhibit	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30253414		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	15780580		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38256082	Associate	★☆☆☆☆ Found in Text Mining only
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	31851787	Associate	★☆☆☆☆ Found in Text Mining only
Conotruncal defect	Conotruncal defect	BEFREE	29399948, 31851787		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28843170		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27224303, 30016149		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27224303, 30016149		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28542222		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	27958883		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	10985961		★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	18544920		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	18544920		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27958883		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	31813265		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33329553	Associate	★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	34014839	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	26210445	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17468103	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29988126		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31869414	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	15297967, 31693398		★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	15297967		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35714567	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30760648		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	18560520, 38286121	Associate	★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	18560520		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	31869414	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27264783, 27566554		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19490803		★☆☆☆☆ Found in Text Mining only
Necrotizing Enterocolitis	Necrotizing Enterocolitis	BEFREE	26845626		★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	26845626		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27658048, 28288548, 30661098		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24041990		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	18560520	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18560520		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27958883		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27958883, 28542222		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30858124		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	38494731	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	18560520, 38203854	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22816731, 25355420, 27224303, 29183158		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29988126, 31813265		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	26507871		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	15297967		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	30380418		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12532421		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27958883		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Stimulate	★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	24799429	Associate	★☆☆☆☆ Found in Text Mining only