Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2740
Gene name	Glucagon like peptide 1 receptor
Gene symbol	GLP1R
Synonyms (NCBI Gene)	GLP-1GLP-1-RGLP-1R
Chromosome	6
Chromosome location	6p21.2
Summary	This gene encodes a 7-transmembrane protein that functions as a receptor for glucagon-like peptide 1 (GLP-1) hormone, which stimulates glucose-induced insulin secretion. This receptor, which functions at the cell surface, becomes internalized in response

184

Show/Hide all (184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT640779	hsa-miR-4308	HITS-CLIP	23824327
MIRT640778	hsa-miR-4292	HITS-CLIP	23824327
MIRT640777	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT640776	hsa-miR-4780	HITS-CLIP	23824327
MIRT640775	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT628188	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	23824327
MIRT628185	hsa-miR-4669	HITS-CLIP	23824327
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT640771	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT640768	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT628182	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT640779	hsa-miR-4308	HITS-CLIP	23824327
MIRT640778	hsa-miR-4292	HITS-CLIP	23824327
MIRT640777	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT640776	hsa-miR-4780	HITS-CLIP	23824327
MIRT640775	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT628188	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	23824327
MIRT628185	hsa-miR-4669	HITS-CLIP	23824327
MIRT640774	hsa-miR-623	HITS-CLIP	23824327
MIRT640773	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT640772	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT640771	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT640770	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT640769	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT640768	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT628188	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	23824327
MIRT628185	hsa-miR-4669	HITS-CLIP	23824327
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT628182	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	27418678
MIRT628186	hsa-miR-3657	HITS-CLIP	27418678
MIRT628186	hsa-miR-3657	HITS-CLIP	27418678
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	27418678
MIRT628185	hsa-miR-4669	HITS-CLIP	27418678
MIRT628185	hsa-miR-4669	HITS-CLIP	27418678
MIRT628185	hsa-miR-4669	HITS-CLIP	27418678
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	27418678
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	27418678
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	27418678
MIRT628182	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT628182	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT628182	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	27418678
MIRT640779	hsa-miR-4308	HITS-CLIP	23824327
MIRT640778	hsa-miR-4292	HITS-CLIP	23824327
MIRT640777	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT640776	hsa-miR-4780	HITS-CLIP	23824327
MIRT640775	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT628188	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	23824327
MIRT628185	hsa-miR-4669	HITS-CLIP	23824327
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT640771	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT640768	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT628182	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT640779	hsa-miR-4308	HITS-CLIP	23824327
MIRT640778	hsa-miR-4292	HITS-CLIP	23824327
MIRT640777	hsa-miR-6791-5p	HITS-CLIP	23824327
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT640776	hsa-miR-4780	HITS-CLIP	23824327
MIRT640775	hsa-miR-6780b-3p	HITS-CLIP	23824327
MIRT628188	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	23824327
MIRT628185	hsa-miR-4669	HITS-CLIP	23824327
MIRT640774	hsa-miR-623	HITS-CLIP	23824327
MIRT640773	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT640772	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT640771	hsa-miR-4433b-5p	HITS-CLIP	23824327
MIRT640770	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT640769	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT640768	hsa-miR-4646-3p	HITS-CLIP	23824327
MIRT628189	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT628188	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT628187	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT628186	hsa-miR-3657	HITS-CLIP	23824327
MIRT628185	hsa-miR-4669	HITS-CLIP	23824327
MIRT628184	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT628183	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT628182	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT1021366	hsa-miR-122	CLIP-seq
MIRT1021367	hsa-miR-150	CLIP-seq
MIRT1021368	hsa-miR-2110	CLIP-seq
MIRT1021369	hsa-miR-3150a-3p	CLIP-seq
MIRT1021370	hsa-miR-3153	CLIP-seq
MIRT1021371	hsa-miR-3175	CLIP-seq
MIRT1021372	hsa-miR-3192	CLIP-seq
MIRT1021373	hsa-miR-4260	CLIP-seq
MIRT1021374	hsa-miR-4271	CLIP-seq
MIRT1021375	hsa-miR-4428	CLIP-seq
MIRT1021376	hsa-miR-4667-5p	CLIP-seq
MIRT1021377	hsa-miR-4700-5p	CLIP-seq
MIRT1021378	hsa-miR-4713-5p	CLIP-seq
MIRT1021379	hsa-miR-4725-3p	CLIP-seq
MIRT1021380	hsa-miR-4728-5p	CLIP-seq
MIRT1021381	hsa-miR-532-3p	CLIP-seq
MIRT1021382	hsa-miR-548a-5p	CLIP-seq
MIRT1021383	hsa-miR-548ab	CLIP-seq
MIRT1021384	hsa-miR-548ak	CLIP-seq
MIRT1021385	hsa-miR-548b-5p	CLIP-seq
MIRT1021386	hsa-miR-548c-5p	CLIP-seq
MIRT1021387	hsa-miR-548d-5p	CLIP-seq
MIRT1021388	hsa-miR-548h	CLIP-seq
MIRT1021389	hsa-miR-548i	CLIP-seq
MIRT1021390	hsa-miR-548j	CLIP-seq
MIRT1021391	hsa-miR-548k	CLIP-seq
MIRT1021392	hsa-miR-548l	CLIP-seq
MIRT1021393	hsa-miR-548w	CLIP-seq
MIRT1021394	hsa-miR-548y	CLIP-seq
MIRT1021395	hsa-miR-559	CLIP-seq
MIRT1021396	hsa-miR-593	CLIP-seq
MIRT1021397	hsa-miR-637	CLIP-seq
MIRT1021398	hsa-miR-647	CLIP-seq
MIRT1021399	hsa-miR-939	CLIP-seq
MIRT2235612	hsa-miR-1301	CLIP-seq
MIRT2235613	hsa-miR-1915	CLIP-seq
MIRT2235614	hsa-miR-3120-5p	CLIP-seq
MIRT2235615	hsa-miR-34a	CLIP-seq
MIRT2235616	hsa-miR-34c-5p	CLIP-seq
MIRT2235617	hsa-miR-3612	CLIP-seq
MIRT2235618	hsa-miR-4459	CLIP-seq
MIRT2235619	hsa-miR-449a	CLIP-seq
MIRT2235620	hsa-miR-449b	CLIP-seq
MIRT2235621	hsa-miR-4641	CLIP-seq
MIRT2235622	hsa-miR-4691-3p	CLIP-seq
MIRT2235623	hsa-miR-4695-5p	CLIP-seq
MIRT2235624	hsa-miR-4726-3p	CLIP-seq
MIRT2235625	hsa-miR-502-5p	CLIP-seq
MIRT2235626	hsa-miR-5047	CLIP-seq
MIRT2235627	hsa-miR-650	CLIP-seq
MIRT2235628	hsa-miR-665	CLIP-seq
MIRT2450361	hsa-miR-3150b-3p	CLIP-seq
MIRT2450362	hsa-miR-3663-3p	CLIP-seq
MIRT2450363	hsa-miR-4254	CLIP-seq
MIRT2450364	hsa-miR-4434	CLIP-seq
MIRT2450365	hsa-miR-4516	CLIP-seq
MIRT2450366	hsa-miR-4784	CLIP-seq
MIRT2450367	hsa-miR-619	CLIP-seq
MIRT2450368	hsa-miR-765	CLIP-seq
MIRT2450361	hsa-miR-3150b-3p	CLIP-seq
MIRT2450362	hsa-miR-3663-3p	CLIP-seq
MIRT2450363	hsa-miR-4254	CLIP-seq
MIRT2450364	hsa-miR-4434	CLIP-seq
MIRT2450365	hsa-miR-4516	CLIP-seq
MIRT2450366	hsa-miR-4784	CLIP-seq
MIRT2450367	hsa-miR-619	CLIP-seq
MIRT2450368	hsa-miR-765	CLIP-seq
MIRT2450361	hsa-miR-3150b-3p	CLIP-seq
MIRT2450362	hsa-miR-3663-3p	CLIP-seq
MIRT2450363	hsa-miR-4254	CLIP-seq
MIRT2450364	hsa-miR-4434	CLIP-seq
MIRT2450365	hsa-miR-4516	CLIP-seq
MIRT2450366	hsa-miR-4784	CLIP-seq
MIRT2450367	hsa-miR-619	CLIP-seq
MIRT2450368	hsa-miR-765	CLIP-seq
MIRT2450361	hsa-miR-3150b-3p	CLIP-seq
MIRT2450362	hsa-miR-3663-3p	CLIP-seq
MIRT2450363	hsa-miR-4254	CLIP-seq
MIRT2450364	hsa-miR-4434	CLIP-seq
MIRT2450365	hsa-miR-4516	CLIP-seq
MIRT2450366	hsa-miR-4784	CLIP-seq
MIRT2450367	hsa-miR-619	CLIP-seq
MIRT2450368	hsa-miR-765	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	8405712
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004967	Function	Glucagon receptor activity	IBA
GO:0004967	Function	Glucagon receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28514449
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8405712
GO:0007165	Process	Signal transduction	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	28514449
GO:0007190	Process	Activation of adenylate cyclase activity	TAS	8405712
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	IDA	7589461
GO:0007611	Process	Learning or memory	IEA
GO:0008016	Process	Regulation of heart contraction	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8405712
GO:0017046	Function	Peptide hormone binding	IBA
GO:0031204	Process	Post-translational protein targeting to membrane, translocation	IEA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0044508	Function	Glucagon-like peptide 1 receptor activity	IBA
GO:0044508	Function	Glucagon-like peptide 1 receptor activity	IDA	28514449
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045777	Process	Positive regulation of blood pressure	IBA
GO:0045777	Process	Positive regulation of blood pressure	IEA
GO:0046879	Process	Hormone secretion	IEA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0071377	Process	Cellular response to glucagon stimulus	IEA
GO:1990911	Process	Response to psychosocial stress	IEA

MIM	HGNC	e!Ensembl
138032	4324	ENSG00000112164

P43220

Protein name

Glucagon-like peptide 1 receptor (GLP-1 receptor) (GLP-1-R) (GLP-1R)

Protein function

G-protein coupled receptor for glucagon-like peptide 1 (GLP-1) (PubMed:19861722, PubMed:26308095, PubMed:27196125, PubMed:28514449, PubMed:7517895, PubMed:8216285, PubMed:8405712). Ligand binding triggers activation of a signaling cascade that l

PDB

3C59 , 3C5T , 3IOL , 4ZGM , 5E94 , 5NX2 , 5OTT , 5OTU , 5OTV , 5OTW , 5OTX , 5VEW , 5VEX , 6B3J , 6GB1 , 6ORV , 6VCB , 6X18 , 6X19 , 6X1A , 6XOX , 7C2E , 7DUQ , 7DUR , 7E14 , 7EVM , 7FIM , 7KI0 , 7KI1 , 7LCI , 7LCJ , 7LCK , 7LLL , 7LLY , 7RG9 , 7RGP , 7RTB , 7S15 , 7S1M , 7S3I , 7VBH , 7VBI , 7X8R , 7X8S , 8JIP , 8JIR , 8JIS , 8WG7 , 8YW3 , 9IVG , 9IVM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02793	HRM	59 → 129	Hormone receptor domain	Family
PF00002	7tm_2	141 → 398	7 transmembrane receptor (Secretin family)	Family

Sequence

MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS

Sequence length

463

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Insulin secretion		Glucagon-like Peptide-1 (GLP1) regulates insulin secretion G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (267)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	30948746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	28847797, 31794876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28105738, 30109766, 31750601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	27624071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	29399966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	29539609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31686522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	8642313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	31616396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	23020846	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29235507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	25848859	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	Pubtator	32213216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26238361, 26495786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28633506, 28757640, 28964791, 29433086, 29680267, 30959513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30683681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30683681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25876091, 30103898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	31616396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23469279, 28445811, 28608285, 28734203, 28830217, 29220092, 29283509, 29325849, 29884547, 31270216, 31747801, 31778747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	30897288	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34502360	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	29070572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27928844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	20495843, 33854404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23469279, 28445811, 28608285, 28734203, 29220092, 29283509, 29325849, 29884547, 31270216, 31747801, 31778747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29283509	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28569363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	30881319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	36589856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	29771387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Avoidant Restrictive Food Intake Disorder	Avoidant restrictive food intake disorder	Pubtator	35700837, 36592795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	23471186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	27721184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	28808865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31680842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21638053, 29045658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31776304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39777709	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	28808865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	28469580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	28846695, 29407005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	Pubtator	28846695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	29231147, 29407005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	29803903		★★★★★ ★☆☆☆☆ Found in Text Mining only
C-cell hyperplasia of thyroid	Thyroid Hyperplasia	BEFREE	20203154, 28213092, 28454451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	25407893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36353638, 39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	BEFREE	30068284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	39777709	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22963445, 23469279, 28847797, 29216336, 29402981, 29445896, 29805980, 29858866, 29865997, 29895290, 29935211, 30084684, 30103898, 30227157, 30251174 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	30271789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	27862873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	31037120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24201448, 28122257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	19164583, 28122257, 28477558, 28489279, 28501352, 28522196, 28912645, 29113708, 29221659, 29411931, 29705602, 29865997, 30144405, 30223891, 30406850 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	28986282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	29637584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	30518618, 31691043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	BEFREE	30137354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	Pubtator	39366640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	28244632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	28366423, 28432726, 31261624, 31422062, 31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	25030617, 28366423, 28566304, 29590132, 30753708, 30823876, 31124035, 31531806, 31795376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	24092637, 28560433, 30349227, 30836679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28552096		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28456941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28318339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21636702, 29283894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21636702, 39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	22855730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27610604, 27653447, 28086882, 28242257, 28431666, 28501352, 29221659, 29520964, 29603541, 29682682, 29805980, 30196071, 30259198, 30332619, 30348145 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22240132, 27252175, 28514806, 30271789, 30823876, 31231210, 31257516, 31821814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22240132, 27252175, 27797930, 28124822, 28514806, 30271789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30271789, 33544567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27252175, 33854404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22240132, 27252175, 28514806, 30271789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	30271789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	28337255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28776152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30259623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	29434185, 31182934, 31497200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31300920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30831439, 31153593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15642594, 17164779, 20082866, 20856794, 21029027, 21347622, 21495117, 22951144, 23019069, 24719110, 25483438, 25626737, 25834231, 26642437, 26648451 View all (103 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15642594, 17164779, 20082866, 20856794, 21029027, 21347622, 21495117, 21647189, 22951144, 23019069, 24687535, 24719110, 25483438, 25626737, 25834231 View all (114 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	24687535, 26598711, 31174433, 31540136, 31691451, 35498407, 38354757	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	26734798, 28801559	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36589856, 38629877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18287102, 20002095, 21616920, 23365488, 24712679, 25631608, 25785276, 26820940, 27252175, 27858848, 28035964, 28283573, 28822994, 30271789, 30942623 View all (18 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23020846, 23879380, 24648662, 32229084	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36614270	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12659868, 17164779, 20225396, 20856794, 27868372, 28211611, 28616805, 28711285, 29659867, 29991320, 30041175, 30209797, 30234389, 30536789, 30612138 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11124853, 14529486, 14719796, 15155141, 15364163, 15642594, 15780433, 15975668, 15983230, 17928588, 18430365, 19164583, 19190262, 20115929, 20421298 View all (433 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	30718926		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	28711285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	21562063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31799782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	30429124, 31456304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31578193	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	22963445, 23159951, 29137984, 29216336, 29717107, 29845208, 30110568, 30575943, 30961500, 31136032, 31578193, 31714285, 31759969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	25483438, 28533296, 29104476, 30058208, 30150234, 30862093, 31589290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	36737746	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	37709961	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Duodenitis	Duodenitis	Pubtator	40281248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	29771387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28772236, 29275178, 29325849, 30836679, 31068828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	37364698	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	28846695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31779652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	27246810	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine System Diseases	BEFREE	31600725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26648451, 29907137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29907137, 38269495, 39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	36142272	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	29331643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30770099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	30770099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	22363635, 28870812, 30359962, 30510243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	32414752, 34078383, 35140289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37511368	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Alcoholic	Fatty liver, alcoholic	Pubtator	32414752	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	21745271, 28349245, 28677333, 29107284, 30359962, 30510243, 30578967, 30961499, 31058888, 31082799, 31180545, 31672448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	BEFREE	30086287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	21095545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	30690693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30119208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31759969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucagonoma	Glucagonoma	BEFREE	3840748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	27252175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29107282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27610604, 27653447, 28086882, 28242257, 28431666, 28501352, 29221659, 29520964, 29603541, 29682682, 29805980, 30196071, 30259198, 30332619, 30348145 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	34184541	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	26759261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29224011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30149534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	30149534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	28835515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	31229924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10415574, 11124853, 22547676, 25483438, 25626737, 26315270, 26621478, 28115994, 28274140, 28431669, 28452237, 28463898, 28579289, 28683295, 28710307 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23365488, 34509564, 39536975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23985558	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	BEFREE	27915035, 27975209, 30086874, 31243576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	17989064, 19833888, 21638053, 24947356, 27232339, 30312651, 30650080, 30738010, 30938760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	30026275, 30513370, 31321014, 31514971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	20040695	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	33001556	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22228705		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	27475229, 29805980, 31336911, 31537818, 31729903, 31747801		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	28452237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	25263215, 27800649, 27913575, 27975209, 28224463, 28294702, 28379427, 28401444, 28625506, 28721686, 28741970, 28786125, 28816532, 28836861, 28855269 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28870812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28062257, 30465895, 31082410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29813107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	23365488, 35498407	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	21095545, 21210113, 22075645, 22112810, 25119061, 28089587, 28103285, 28365524, 28400403, 28947919, 28953210, 30054698, 30504139, 30560451, 30617961 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31121089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	24577752, 31423269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	20518750, 28215540, 31121089, 31602785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28522196, 31307484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	28710307, 30234389, 31070711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28366423, 28431667, 29113708, 29590132, 29845208, 30058208, 30223891, 30298444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	27677385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31795376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	28366423, 28432726, 31261624, 31422062, 31531806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	29221794, 30683681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28319060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28552096, 31177870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	40281248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	24092637, 28560433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21638053, 29045658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26648451, 29907137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16644694, 26238361, 28244632, 30109766, 30135132, 30787365, 31750601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30009503, 30068284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	23471186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26120834, 30990084, 31420784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28318339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	21761282, 7958545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28454451, 30135132, 30171481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30831439, 31153593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30409537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	28684145, 28777938, 29107284, 29617641, 29717000, 30296922, 30578967, 30863364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	20470376	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25376528, 29539609, 29958403, 30204504, 30836679, 31542859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	30637442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28867303, 29481915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	29335487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	31020810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28242257, 28483802, 28847797, 29221659, 29444223, 29947247, 30033664, 30547299, 30823876, 31436559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	30823876, 31231210, 31257516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	29947247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33009421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	29771387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22112810, 24577752, 25119061, 26078577, 26120834, 26238361, 28089587, 28094469, 28319060, 29226686, 29356866, 29843149, 29877881, 30068284, 30119208 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	23471186		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28846606, 29129776, 29705602, 29892066, 30770099, 31082410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	20374430, 24201448, 31628935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20374430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	20374430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	20374430, 28846606, 28927992, 29113464, 29329976, 29412810, 30688255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	22112810, 25119061, 29399966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	31514971, 31682045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21745271, 24264040, 28319060, 28431668, 28552096, 28681988, 28867301, 28918389, 30359962, 30405191, 30459715, 30510243, 30578967, 30961499, 31236111, 31412267, 31418344, 31672448 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21745271, 28847797, 30359962, 30510243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29548996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	16685426, 21638053, 21862620, 23019069, 23990519, 24969551, 25376673, 25713030, 26001373, 26015316, 26381270, 27405092, 27636208, 27717222, 28003008 View all (63 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20040695	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23900445, 24687535, 25561730, 29972795, 32344198, 34290670, 35655162, 35894080, 36339410, 36592795, 36720576, 36774542, 37709961, 38461904, 38629877, 39777709 View all (1 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity, Morbid	Obesity	BEFREE	31000783		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31256933, 31321014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	32527131, 38096145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16644694, 26238361, 28244632, 30109766, 30135132, 30787365, 31750601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic diseases	Pubtator	25216224	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	30607480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26238361, 26495786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	16644694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31420784		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34489868, 39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	20835917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	27974199, 28244632, 31727181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	22266668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29200876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28387682, 28666800, 28927992, 28991675, 29113464, 29329976, 29402504, 29462693, 29549796, 29705602, 30017231, 30070753, 30120857, 30144405, 30556245, 30741689 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31654678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	19164583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30451975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	20082866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	20082866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31686522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	25991051, 28003008, 28276778, 28432082, 28681988, 30652641, 31229399, 31593246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	27071367, 29335890, 30614551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31300920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30009503, 30068284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	30844468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29548996, 30409537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30349227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30836679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	BEFREE	28432082, 30448278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28070733, 29547044, 29756388, 30348145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29607314, 30648566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	29113708, 29431519, 30223891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28070733, 29547044, 29756388, 30348145, 30897288, 31336333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27717222, 30187620, 30745885		★★★★★ ★☆☆☆☆ Found in Text Mining only
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	28469580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	31082410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29334697, 31795376		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30844468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	BEFREE	31321014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29549796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	22363635, 28870812, 29344336, 30359962, 30510243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28986282, 30935689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	31260047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	39777709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33684886	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	30019398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	20495843	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31471633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular arrhythmia	Ventricular arrhythmia	BEFREE	30354404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	30054673, 31673100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram syndrome	Pubtator	40202504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GLP1R (glucagon like peptide 1 receptor)