Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27315
Gene name	Post-GPI attachment to proteins 2
Gene symbol	PGAP2
Synonyms (NCBI Gene)	CWH43-NFRAG1HPMRS3MRT17MRT21
Chromosome	11
Chromosome location	11p15.4
Summary	The protein encoded by this gene plays a role in the maturation of glycosylphosphatidylinositol (GPI) anchors on GPI-anchored proteins. Mutations in this gene are associated with an autosomal recessive syndrome characterized by hyperphosphatasia and intel

Show/Hide all (10)

SNP ID	Visualize variation	Clinical significance	Consequence
rs587776970	C>T	Pathogenic	Intron variant, coding sequence variant, missense variant, synonymous variant, non coding transcript variant
rs747658866	C>T	Likely-pathogenic	Missense variant, 3 prime UTR variant, coding sequence variant, non coding transcript variant
rs752346360	C>G,T	Likely-pathogenic	Coding sequence variant, non coding transcript variant, intron variant, synonymous variant, missense variant
rs773359554	C>T	Pathogenic	Intron variant, genic upstream transcript variant, non coding transcript variant, synonymous variant, missense variant, coding sequence variant, 5 prime UTR variant
rs774843232	G>A,C,T	Pathogenic	Coding sequence variant, non coding transcript variant, synonymous variant, missense variant
rs879255232	A>G	Pathogenic	Synonymous variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
rs879255233	T>C	Pathogenic	Synonymous variant, missense variant, non coding transcript variant, coding sequence variant, intron variant
rs1590215915	T>G	Pathogenic	Non coding transcript variant, 5 prime UTR variant, coding sequence variant, genic upstream transcript variant, initiator codon variant, missense variant, intron variant
rs1590414630	G>T	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained, missense variant, intron variant
rs1590416370	T>C	Likely-pathogenic	Non coding transcript variant, coding sequence variant, missense variant, intron variant, synonymous variant

168

Show/Hide all (168)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439993	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439993	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1227114	hsa-miR-101	CLIP-seq
MIRT1227115	hsa-miR-1224-5p	CLIP-seq
MIRT1227116	hsa-miR-1253	CLIP-seq
MIRT1227117	hsa-miR-1254	CLIP-seq
MIRT1227118	hsa-miR-1266	CLIP-seq
MIRT1227119	hsa-miR-1304	CLIP-seq
MIRT1227120	hsa-miR-144	CLIP-seq
MIRT1227121	hsa-miR-296-3p	CLIP-seq
MIRT1227122	hsa-miR-3116	CLIP-seq
MIRT1227123	hsa-miR-3664-3p	CLIP-seq
MIRT1227124	hsa-miR-3915	CLIP-seq
MIRT1227125	hsa-miR-3942-3p	CLIP-seq
MIRT1227126	hsa-miR-4260	CLIP-seq
MIRT1227127	hsa-miR-4270	CLIP-seq
MIRT1227128	hsa-miR-4441	CLIP-seq
MIRT1227129	hsa-miR-4518	CLIP-seq
MIRT1227130	hsa-miR-4650-5p	CLIP-seq
MIRT1227131	hsa-miR-4689	CLIP-seq
MIRT1227132	hsa-miR-4751	CLIP-seq
MIRT1227133	hsa-miR-4757-5p	CLIP-seq
MIRT1227134	hsa-miR-4764-5p	CLIP-seq
MIRT1227135	hsa-miR-4768-3p	CLIP-seq
MIRT1227136	hsa-miR-548m	CLIP-seq
MIRT1227137	hsa-miR-582-5p	CLIP-seq
MIRT1227138	hsa-miR-635	CLIP-seq
MIRT1227139	hsa-miR-7	CLIP-seq
MIRT1227140	hsa-miR-936	CLIP-seq
MIRT2066552	hsa-miR-1245b-3p	CLIP-seq
MIRT2066553	hsa-miR-2110	CLIP-seq
MIRT2066554	hsa-miR-24	CLIP-seq
MIRT2066555	hsa-miR-2909	CLIP-seq
MIRT1227121	hsa-miR-296-3p	CLIP-seq
MIRT2066556	hsa-miR-3202	CLIP-seq
MIRT1227127	hsa-miR-4270	CLIP-seq
MIRT2066557	hsa-miR-4271	CLIP-seq
MIRT2066558	hsa-miR-4330	CLIP-seq
MIRT1227128	hsa-miR-4441	CLIP-seq
MIRT2066559	hsa-miR-4651	CLIP-seq
MIRT2066560	hsa-miR-4725-3p	CLIP-seq
MIRT2066561	hsa-miR-4747-5p	CLIP-seq
MIRT1227135	hsa-miR-4768-3p	CLIP-seq
MIRT2066562	hsa-miR-608	CLIP-seq
MIRT1227139	hsa-miR-7	CLIP-seq
MIRT1227118	hsa-miR-1266	CLIP-seq
MIRT1227121	hsa-miR-296-3p	CLIP-seq
MIRT2293918	hsa-miR-29a	CLIP-seq
MIRT2293919	hsa-miR-29b	CLIP-seq
MIRT2293920	hsa-miR-29c	CLIP-seq
MIRT2293921	hsa-miR-3165	CLIP-seq
MIRT2293922	hsa-miR-3189-3p	CLIP-seq
MIRT1227123	hsa-miR-3664-3p	CLIP-seq
MIRT2293923	hsa-miR-3978	CLIP-seq
MIRT2293924	hsa-miR-4258	CLIP-seq
MIRT1227127	hsa-miR-4270	CLIP-seq
MIRT1227128	hsa-miR-4441	CLIP-seq
MIRT2293925	hsa-miR-4451	CLIP-seq
MIRT1227129	hsa-miR-4518	CLIP-seq
MIRT2293926	hsa-miR-455-3p	CLIP-seq
MIRT1227133	hsa-miR-4757-5p	CLIP-seq
MIRT1227135	hsa-miR-4768-3p	CLIP-seq
MIRT2293927	hsa-miR-485-3p	CLIP-seq
MIRT2293928	hsa-miR-487a	CLIP-seq
MIRT2293929	hsa-miR-522	CLIP-seq
MIRT1227136	hsa-miR-548m	CLIP-seq
MIRT1227139	hsa-miR-7	CLIP-seq
MIRT1227140	hsa-miR-936	CLIP-seq
MIRT2392431	hsa-miR-1299	CLIP-seq
MIRT2392432	hsa-miR-4782-5p	CLIP-seq
MIRT2392433	hsa-miR-516b	CLIP-seq
MIRT2456284	hsa-miR-3591-3p	CLIP-seq
MIRT2456285	hsa-miR-4773	CLIP-seq
MIRT2592026	hsa-miR-1193	CLIP-seq
MIRT2592027	hsa-miR-1243	CLIP-seq
MIRT1227116	hsa-miR-1253	CLIP-seq
MIRT1227118	hsa-miR-1266	CLIP-seq
MIRT2592028	hsa-miR-1273g	CLIP-seq
MIRT2592029	hsa-miR-1283	CLIP-seq
MIRT2392431	hsa-miR-1299	CLIP-seq
MIRT2592030	hsa-miR-134	CLIP-seq
MIRT2592031	hsa-miR-138	CLIP-seq
MIRT2592032	hsa-miR-1973	CLIP-seq
MIRT2592033	hsa-miR-2467-3p	CLIP-seq
MIRT2592034	hsa-miR-3118	CLIP-seq
MIRT2592035	hsa-miR-3121-5p	CLIP-seq
MIRT2592036	hsa-miR-3173-3p	CLIP-seq
MIRT2592037	hsa-miR-323-5p	CLIP-seq
MIRT2592038	hsa-miR-323b-5p	CLIP-seq
MIRT2592039	hsa-miR-331-5p	CLIP-seq
MIRT2592040	hsa-miR-3618	CLIP-seq
MIRT2592041	hsa-miR-3678-3p	CLIP-seq
MIRT2592042	hsa-miR-3907	CLIP-seq
MIRT2592043	hsa-miR-3919	CLIP-seq
MIRT1227125	hsa-miR-3942-3p	CLIP-seq
MIRT2592044	hsa-miR-4252	CLIP-seq
MIRT1227127	hsa-miR-4270	CLIP-seq
MIRT2592045	hsa-miR-4276	CLIP-seq
MIRT2592046	hsa-miR-4283	CLIP-seq
MIRT1227128	hsa-miR-4441	CLIP-seq
MIRT2592047	hsa-miR-4484	CLIP-seq
MIRT2592048	hsa-miR-450b-5p	CLIP-seq
MIRT1227129	hsa-miR-4518	CLIP-seq
MIRT2592049	hsa-miR-4678	CLIP-seq
MIRT2592050	hsa-miR-4687-3p	CLIP-seq
MIRT2592051	hsa-miR-4691-3p	CLIP-seq
MIRT2592052	hsa-miR-4728-5p	CLIP-seq
MIRT2592053	hsa-miR-4733-5p	CLIP-seq
MIRT2592054	hsa-miR-4738-3p	CLIP-seq
MIRT2592055	hsa-miR-4753-5p	CLIP-seq
MIRT2592056	hsa-miR-4779	CLIP-seq
MIRT2392432	hsa-miR-4782-5p	CLIP-seq
MIRT2592057	hsa-miR-4793-5p	CLIP-seq
MIRT2592058	hsa-miR-488	CLIP-seq
MIRT2592059	hsa-miR-501-5p	CLIP-seq
MIRT2392433	hsa-miR-516b	CLIP-seq
MIRT2592060	hsa-miR-518a-5p	CLIP-seq
MIRT2592061	hsa-miR-527	CLIP-seq
MIRT2592062	hsa-miR-539	CLIP-seq
MIRT2592063	hsa-miR-548an	CLIP-seq
MIRT2592064	hsa-miR-548q	CLIP-seq
MIRT2592065	hsa-miR-767-3p	CLIP-seq
MIRT2592066	hsa-miR-876-3p	CLIP-seq
MIRT2592067	hsa-miR-892a	CLIP-seq
MIRT2592068	hsa-miR-943	CLIP-seq
MIRT1227116	hsa-miR-1253	CLIP-seq
MIRT1227118	hsa-miR-1266	CLIP-seq
MIRT2592028	hsa-miR-1273g	CLIP-seq
MIRT2592029	hsa-miR-1283	CLIP-seq
MIRT2392431	hsa-miR-1299	CLIP-seq
MIRT2592030	hsa-miR-134	CLIP-seq
MIRT2592031	hsa-miR-138	CLIP-seq
MIRT2592032	hsa-miR-1973	CLIP-seq
MIRT2592033	hsa-miR-2467-3p	CLIP-seq
MIRT2592034	hsa-miR-3118	CLIP-seq
MIRT2592035	hsa-miR-3121-5p	CLIP-seq
MIRT2592036	hsa-miR-3173-3p	CLIP-seq
MIRT2592038	hsa-miR-323b-5p	CLIP-seq
MIRT2592040	hsa-miR-3618	CLIP-seq
MIRT2592041	hsa-miR-3678-3p	CLIP-seq
MIRT2592042	hsa-miR-3907	CLIP-seq
MIRT2592043	hsa-miR-3919	CLIP-seq
MIRT1227125	hsa-miR-3942-3p	CLIP-seq
MIRT2592044	hsa-miR-4252	CLIP-seq
MIRT1227127	hsa-miR-4270	CLIP-seq
MIRT2592045	hsa-miR-4276	CLIP-seq
MIRT2592046	hsa-miR-4283	CLIP-seq
MIRT1227128	hsa-miR-4441	CLIP-seq
MIRT2592047	hsa-miR-4484	CLIP-seq
MIRT2592048	hsa-miR-450b-5p	CLIP-seq
MIRT1227129	hsa-miR-4518	CLIP-seq
MIRT2592050	hsa-miR-4687-3p	CLIP-seq
MIRT2592051	hsa-miR-4691-3p	CLIP-seq
MIRT2592052	hsa-miR-4728-5p	CLIP-seq
MIRT2592053	hsa-miR-4733-5p	CLIP-seq
MIRT2592055	hsa-miR-4753-5p	CLIP-seq
MIRT2592056	hsa-miR-4779	CLIP-seq
MIRT2392432	hsa-miR-4782-5p	CLIP-seq
MIRT2592058	hsa-miR-488	CLIP-seq
MIRT2392433	hsa-miR-516b	CLIP-seq
MIRT2592060	hsa-miR-518a-5p	CLIP-seq
MIRT2592061	hsa-miR-527	CLIP-seq
MIRT2592062	hsa-miR-539	CLIP-seq
MIRT2592063	hsa-miR-548an	CLIP-seq
MIRT2592064	hsa-miR-548q	CLIP-seq
MIRT2592065	hsa-miR-767-3p	CLIP-seq
MIRT2592067	hsa-miR-892a	CLIP-seq
MIRT2592068	hsa-miR-943	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	ISS
GO:0005515	Function	Protein binding	IPI	25416956, 26871637, 32296183
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005794	Component	Golgi apparatus	IEA
GO:0006506	Process	GPI anchor biosynthetic process	IBA
GO:0006506	Process	GPI anchor biosynthetic process	IDA	23561846
GO:0006506	Process	GPI anchor biosynthetic process	IEA
GO:0006506	Process	GPI anchor biosynthetic process	IMP	29374258
GO:0006506	Process	GPI anchor biosynthetic process	ISS
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	10585768
GO:0016740	Function	Transferase activity	IEA

MIM	HGNC	e!Ensembl
615187	17893	ENSG00000148985

Q9UHJ9

Protein name

Acyltransferase PGAP2 (EC 2.3.-.-) (FGF receptor-activating protein 1) (Post-GPI attachment to proteins factor 2)

Protein function

Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the second step of the fatty acid remodeling, by reacylat

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10277	Frag1	18 → 241	Frag1/DRAM/Sfk1 family	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in testis and pancreas. {ECO:0000269|PubMed:10585768}.

Sequence

MYQVPLPLDRDGTLVRLRFTMVALVTVCCPLVAFLFCILWSLLFHFKETTATHCGVPNYL
PSVSSAIGGEVPQRYVWRFCIGLHSAPRFLVAFAYWNHYLSCTSPCSCYRPLCRLNFGLN
VVENLALLVLTYVSSSEDFTIHENAFIVFIASSLGHMLLTCILWRLTKKHTVSQEDRKSY
SWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGN
KELLITSQPEEKRF

Sequence length

254

Interactions

View interactions

	KEGG
	Glycosylphosphatidylinositol (GPI)-anchor biosynthesis Metabolic pathways

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cerebellar ataxia, intellectual disability, and dysequilibrium syndrome 3	Likely pathogenic; Pathogenic	rs774843232	RCV005644499	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hyperphosphatasia with intellectual disability syndrome 3	Likely pathogenic; Pathogenic	rs1409597701, rs745521288, rs879255232, rs774843232, rs773359554, rs587776970, rs752346360, rs1590215915, rs1590416370, rs1590414630, rs747658866	RCV002225054 RCV003494560 RCV000043535 RCV000043536 RCV000043538 View all (6 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autism spectrum disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital omphalocele	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERPHOSPHATASEMIA WITH INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPHOSPHATASIA WITH IMPAIRED INTELLECTUAL DEVELOPMENT SYNDROME 3	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPHOSPHATASIA-INTELLECTUAL DISABILITY SYNDROME	—	CTD, Orphanet CTD, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoplasia of the corpus callosum	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Micrognathia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MICROGNATHISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PGAP2-related disorder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (45)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Accessory nipple	Accessory Nipple	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Beckwith-Wiedemann Syndrome	Beckwith-Wiedemann Syndrome	BEFREE	10585768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachycephaly	Brachycephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Class III malocclusion	Malocclusion	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of fingers	Clinodactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	40225942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esotropia	Esotropia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Exencephaly	Anencephaly	BEFREE	31232685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	27871432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperopia	Hyperopia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatasia with Mental Retardation	Hyperphosphatasia With Mental Retardation	ORPHANET_DG	23561846, 23561847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatasia with Mental Retardation	Hyperphosphatasia With Mental Retardation	BEFREE	23561847, 24129430, 24417746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatasia with Mental Retardation	Hyperphosphatasia with intellectual disability syndrome	Pubtator	23561847, 24129430, 24417746, 30813920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatasia-intellectual disability syndrome	Hyperphosphatasia With Mental Retardation	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperphosphatemia (disorder)	Hyperphosphatemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	23561846, 24129430, 27871432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	29119105, 30813920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	29119105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10585768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	27871432		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 17	Mental retardation	UNIPROT_DG	23561846, 23561847		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 17	Mental retardation	GENOMICS_ENGLAND_DG	23561847, 27604308		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 17	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 17	Mental retardation	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal Hypotonia	Hypotonia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10585768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Plagiocephaly	Plagiocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

PGAP2 (post-GPI attachment to proteins 2)