Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27303
Gene name	RNA binding motif single stranded interacting protein 3
Gene symbol	RBMS3
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p24.1
Summary	This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1

353

Show/Hide all (353)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028524	hsa-miR-30a-5p	Proteomics	18668040
MIRT031699	hsa-miR-16-5p	Proteomics	18668040
MIRT721515	hsa-miR-1324	HITS-CLIP	19536157
MIRT654314	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT654313	hsa-miR-875-3p	HITS-CLIP	23824327
MIRT654312	hsa-miR-6128	HITS-CLIP	23824327
MIRT654311	hsa-miR-3182	HITS-CLIP	23824327
MIRT654309	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654308	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT654307	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT654306	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT654305	hsa-miR-1299	HITS-CLIP	23824327
MIRT654304	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT654303	hsa-miR-4782-5p	HITS-CLIP	23824327
MIRT654302	hsa-miR-5706	HITS-CLIP	23824327
MIRT654301	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654300	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT654299	hsa-miR-3674	HITS-CLIP	23824327
MIRT654314	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT654313	hsa-miR-875-3p	HITS-CLIP	23824327
MIRT654312	hsa-miR-6128	HITS-CLIP	23824327
MIRT654311	hsa-miR-3182	HITS-CLIP	23824327
MIRT654310	hsa-miR-5093	HITS-CLIP	23824327
MIRT654309	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654308	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT654307	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT654306	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT654305	hsa-miR-1299	HITS-CLIP	23824327
MIRT654304	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT654303	hsa-miR-4782-5p	HITS-CLIP	23824327
MIRT654302	hsa-miR-5706	HITS-CLIP	23824327
MIRT654301	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654300	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT654299	hsa-miR-3674	HITS-CLIP	23824327
MIRT445018	hsa-miR-4282	PAR-CLIP	22100165
MIRT445017	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT445016	hsa-miR-6077	PAR-CLIP	22100165
MIRT445015	hsa-miR-3190-3p	PAR-CLIP	22100165
MIRT445014	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445013	hsa-miR-578	PAR-CLIP	22100165
MIRT721515	hsa-miR-1324	HITS-CLIP	19536157
MIRT654314	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT654313	hsa-miR-875-3p	HITS-CLIP	23824327
MIRT654312	hsa-miR-6128	HITS-CLIP	23824327
MIRT654311	hsa-miR-3182	HITS-CLIP	23824327
MIRT654309	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654308	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT654307	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT654306	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT654305	hsa-miR-1299	HITS-CLIP	23824327
MIRT654304	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT654303	hsa-miR-4782-5p	HITS-CLIP	23824327
MIRT654302	hsa-miR-5706	HITS-CLIP	23824327
MIRT654301	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654300	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT654299	hsa-miR-3674	HITS-CLIP	23824327
MIRT654314	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT654313	hsa-miR-875-3p	HITS-CLIP	23824327
MIRT654312	hsa-miR-6128	HITS-CLIP	23824327
MIRT654311	hsa-miR-3182	HITS-CLIP	23824327
MIRT654310	hsa-miR-5093	HITS-CLIP	23824327
MIRT654309	hsa-miR-4703-3p	HITS-CLIP	23824327
MIRT654308	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT654307	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT654306	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT654305	hsa-miR-1299	HITS-CLIP	23824327
MIRT654304	hsa-miR-516b-5p	HITS-CLIP	23824327
MIRT654303	hsa-miR-4782-5p	HITS-CLIP	23824327
MIRT654302	hsa-miR-5706	HITS-CLIP	23824327
MIRT654301	hsa-miR-670-3p	HITS-CLIP	23824327
MIRT654300	hsa-miR-1238-3p	HITS-CLIP	23824327
MIRT654299	hsa-miR-3674	HITS-CLIP	23824327
MIRT445018	hsa-miR-4282	PAR-CLIP	22100165
MIRT445017	hsa-miR-7-5p	PAR-CLIP	22100165
MIRT445016	hsa-miR-6077	PAR-CLIP	22100165
MIRT445015	hsa-miR-3190-3p	PAR-CLIP	22100165
MIRT445014	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445013	hsa-miR-578	PAR-CLIP	22100165
MIRT1297121	hsa-miR-1267	CLIP-seq
MIRT1297122	hsa-miR-129-5p	CLIP-seq
MIRT1297123	hsa-miR-1305	CLIP-seq
MIRT1297124	hsa-miR-140-3p	CLIP-seq
MIRT1297125	hsa-miR-155	CLIP-seq
MIRT1297126	hsa-miR-2110	CLIP-seq
MIRT1297127	hsa-miR-23a	CLIP-seq
MIRT1297128	hsa-miR-23b	CLIP-seq
MIRT1297129	hsa-miR-23c	CLIP-seq
MIRT1297130	hsa-miR-3149	CLIP-seq
MIRT1297131	hsa-miR-3150a-3p	CLIP-seq
MIRT1297132	hsa-miR-3180-5p	CLIP-seq
MIRT1297133	hsa-miR-338-5p	CLIP-seq
MIRT1297134	hsa-miR-374c	CLIP-seq
MIRT1297135	hsa-miR-380	CLIP-seq
MIRT1297136	hsa-miR-4259	CLIP-seq
MIRT1297137	hsa-miR-4260	CLIP-seq
MIRT1297138	hsa-miR-4307	CLIP-seq
MIRT1297139	hsa-miR-4325	CLIP-seq
MIRT1297140	hsa-miR-4450	CLIP-seq
MIRT1297141	hsa-miR-450b-5p	CLIP-seq
MIRT1297142	hsa-miR-4640-5p	CLIP-seq
MIRT1297143	hsa-miR-4666-5p	CLIP-seq
MIRT1297144	hsa-miR-4726-5p	CLIP-seq
MIRT1297145	hsa-miR-4768-3p	CLIP-seq
MIRT1297146	hsa-miR-4786-5p	CLIP-seq
MIRT1297147	hsa-miR-507	CLIP-seq
MIRT1297148	hsa-miR-513a-3p	CLIP-seq
MIRT1297149	hsa-miR-548ae	CLIP-seq
MIRT1297150	hsa-miR-548aj	CLIP-seq
MIRT1297151	hsa-miR-548am	CLIP-seq
MIRT1297152	hsa-miR-548x	CLIP-seq
MIRT1297153	hsa-miR-556-3p	CLIP-seq
MIRT1297154	hsa-miR-557	CLIP-seq
MIRT1297155	hsa-miR-591	CLIP-seq
MIRT1297156	hsa-miR-607	CLIP-seq
MIRT1297157	hsa-miR-653	CLIP-seq
MIRT1297158	hsa-miR-655	CLIP-seq
MIRT1297159	hsa-miR-665	CLIP-seq
MIRT1297160	hsa-miR-769-5p	CLIP-seq
MIRT1297161	hsa-miR-9	CLIP-seq
MIRT1297162	hsa-miR-105	CLIP-seq
MIRT1297163	hsa-miR-1179	CLIP-seq
MIRT1297121	hsa-miR-1267	CLIP-seq
MIRT1297164	hsa-miR-141	CLIP-seq
MIRT1297165	hsa-miR-200a	CLIP-seq
MIRT1297126	hsa-miR-2110	CLIP-seq
MIRT1297166	hsa-miR-2116	CLIP-seq
MIRT1297167	hsa-miR-3065-5p	CLIP-seq
MIRT1297131	hsa-miR-3150a-3p	CLIP-seq
MIRT1297168	hsa-miR-3163	CLIP-seq
MIRT1297169	hsa-miR-3613-3p	CLIP-seq
MIRT1297170	hsa-miR-3671	CLIP-seq
MIRT1297171	hsa-miR-3692	CLIP-seq
MIRT1297136	hsa-miR-4259	CLIP-seq
MIRT1297137	hsa-miR-4260	CLIP-seq
MIRT1297172	hsa-miR-4310	CLIP-seq
MIRT1297139	hsa-miR-4325	CLIP-seq
MIRT1297140	hsa-miR-4450	CLIP-seq
MIRT1297173	hsa-miR-4452	CLIP-seq
MIRT1297174	hsa-miR-4496	CLIP-seq
MIRT1297142	hsa-miR-4640-5p	CLIP-seq
MIRT1297175	hsa-miR-4652-3p	CLIP-seq
MIRT1297176	hsa-miR-4677-5p	CLIP-seq
MIRT1297177	hsa-miR-4684-3p	CLIP-seq
MIRT1297144	hsa-miR-4726-5p	CLIP-seq
MIRT1297178	hsa-miR-4733-5p	CLIP-seq
MIRT1297179	hsa-miR-4738-3p	CLIP-seq
MIRT1297180	hsa-miR-4766-3p	CLIP-seq
MIRT1297181	hsa-miR-4778-5p	CLIP-seq
MIRT1297182	hsa-miR-505	CLIP-seq
MIRT1297148	hsa-miR-513a-3p	CLIP-seq
MIRT1297183	hsa-miR-548g	CLIP-seq
MIRT1297184	hsa-miR-548p	CLIP-seq
MIRT1297185	hsa-miR-548u	CLIP-seq
MIRT1297186	hsa-miR-570	CLIP-seq
MIRT1297155	hsa-miR-591	CLIP-seq
MIRT1297156	hsa-miR-607	CLIP-seq
MIRT1297157	hsa-miR-653	CLIP-seq
MIRT1297161	hsa-miR-9	CLIP-seq
MIRT1297187	hsa-miR-944	CLIP-seq
MIRT2088301	hsa-miR-4328	CLIP-seq
MIRT2088302	hsa-miR-582-5p	CLIP-seq
MIRT1297156	hsa-miR-607	CLIP-seq
MIRT2088303	hsa-miR-1264	CLIP-seq
MIRT2088304	hsa-miR-1323	CLIP-seq
MIRT2088305	hsa-miR-203	CLIP-seq
MIRT1297126	hsa-miR-2110	CLIP-seq
MIRT1297131	hsa-miR-3150a-3p	CLIP-seq
MIRT2088306	hsa-miR-331-5p	CLIP-seq
MIRT1297136	hsa-miR-4259	CLIP-seq
MIRT1297137	hsa-miR-4260	CLIP-seq
MIRT1297140	hsa-miR-4450	CLIP-seq
MIRT1297142	hsa-miR-4640-5p	CLIP-seq
MIRT2088307	hsa-miR-4670-3p	CLIP-seq
MIRT2088308	hsa-miR-4694-3p	CLIP-seq
MIRT1297144	hsa-miR-4726-5p	CLIP-seq
MIRT2088309	hsa-miR-522	CLIP-seq
MIRT2088310	hsa-miR-548o	CLIP-seq
MIRT2088311	hsa-miR-671-5p	CLIP-seq
MIRT2088312	hsa-miR-760	CLIP-seq
MIRT1297161	hsa-miR-9	CLIP-seq
MIRT1297162	hsa-miR-105	CLIP-seq
MIRT2313261	hsa-miR-1295	CLIP-seq
MIRT1297166	hsa-miR-2116	CLIP-seq
MIRT2313262	hsa-miR-298	CLIP-seq
MIRT1297167	hsa-miR-3065-5p	CLIP-seq
MIRT2313263	hsa-miR-3074-5p	CLIP-seq
MIRT1297168	hsa-miR-3163	CLIP-seq
MIRT2313264	hsa-miR-342-3p	CLIP-seq
MIRT2313265	hsa-miR-3607-3p	CLIP-seq
MIRT2313266	hsa-miR-3655	CLIP-seq
MIRT1297170	hsa-miR-3671	CLIP-seq
MIRT2313267	hsa-miR-3678-3p	CLIP-seq
MIRT1297171	hsa-miR-3692	CLIP-seq
MIRT2313268	hsa-miR-4252	CLIP-seq
MIRT2313269	hsa-miR-4503	CLIP-seq
MIRT1297141	hsa-miR-450b-5p	CLIP-seq
MIRT1297176	hsa-miR-4677-5p	CLIP-seq
MIRT2313270	hsa-miR-4717-5p	CLIP-seq
MIRT2313271	hsa-miR-4795-3p	CLIP-seq
MIRT1297182	hsa-miR-505	CLIP-seq
MIRT1297147	hsa-miR-507	CLIP-seq
MIRT1297149	hsa-miR-548ae	CLIP-seq
MIRT1297150	hsa-miR-548aj	CLIP-seq
MIRT1297151	hsa-miR-548am	CLIP-seq
MIRT1297185	hsa-miR-548u	CLIP-seq
MIRT1297152	hsa-miR-548x	CLIP-seq
MIRT1297154	hsa-miR-557	CLIP-seq
MIRT2313272	hsa-miR-593	CLIP-seq
MIRT1297156	hsa-miR-607	CLIP-seq
MIRT2457958	hsa-miR-371-5p	CLIP-seq
MIRT2457959	hsa-miR-371b-5p	CLIP-seq
MIRT2457960	hsa-miR-495	CLIP-seq
MIRT2457961	hsa-miR-605	CLIP-seq
MIRT2457962	hsa-miR-627	CLIP-seq
MIRT2457963	hsa-miR-664	CLIP-seq
MIRT1297162	hsa-miR-105	CLIP-seq
MIRT2609450	hsa-miR-124	CLIP-seq
MIRT2609451	hsa-miR-1252	CLIP-seq
MIRT2609452	hsa-miR-1279	CLIP-seq
MIRT2609453	hsa-miR-1297	CLIP-seq
MIRT2609454	hsa-miR-1298	CLIP-seq
MIRT2609455	hsa-miR-1304	CLIP-seq
MIRT2609456	hsa-miR-144	CLIP-seq
MIRT2088305	hsa-miR-203	CLIP-seq
MIRT2609457	hsa-miR-2277-3p	CLIP-seq
MIRT2609458	hsa-miR-2392	CLIP-seq
MIRT1297127	hsa-miR-23a	CLIP-seq
MIRT1297128	hsa-miR-23b	CLIP-seq
MIRT1297129	hsa-miR-23c	CLIP-seq
MIRT2609459	hsa-miR-26a	CLIP-seq
MIRT2609460	hsa-miR-26b	CLIP-seq
MIRT2609461	hsa-miR-300	CLIP-seq
MIRT2609462	hsa-miR-3126-5p	CLIP-seq
MIRT2609463	hsa-miR-3143	CLIP-seq
MIRT1297130	hsa-miR-3149	CLIP-seq
MIRT2609464	hsa-miR-3152-5p	CLIP-seq
MIRT2609465	hsa-miR-3160-5p	CLIP-seq
MIRT1297168	hsa-miR-3163	CLIP-seq
MIRT1297132	hsa-miR-3180-5p	CLIP-seq
MIRT2609466	hsa-miR-3646	CLIP-seq
MIRT2609467	hsa-miR-3662	CLIP-seq
MIRT1297170	hsa-miR-3671	CLIP-seq
MIRT2609468	hsa-miR-3672	CLIP-seq
MIRT2609469	hsa-miR-3689d	CLIP-seq
MIRT2609470	hsa-miR-3714	CLIP-seq
MIRT2457958	hsa-miR-371-5p	CLIP-seq
MIRT2457959	hsa-miR-371b-5p	CLIP-seq
MIRT2609471	hsa-miR-374a	CLIP-seq
MIRT2609472	hsa-miR-374b	CLIP-seq
MIRT1297134	hsa-miR-374c	CLIP-seq
MIRT2609473	hsa-miR-381	CLIP-seq
MIRT2609474	hsa-miR-3910	CLIP-seq
MIRT2609475	hsa-miR-3974	CLIP-seq
MIRT2609476	hsa-miR-409-3p	CLIP-seq
MIRT2609477	hsa-miR-4261	CLIP-seq
MIRT2609478	hsa-miR-4263	CLIP-seq
MIRT2609479	hsa-miR-4272	CLIP-seq
MIRT1297138	hsa-miR-4307	CLIP-seq
MIRT2609480	hsa-miR-4419a	CLIP-seq
MIRT2609481	hsa-miR-4443	CLIP-seq
MIRT2609482	hsa-miR-4446-5p	CLIP-seq
MIRT1297173	hsa-miR-4452	CLIP-seq
MIRT2609483	hsa-miR-4459	CLIP-seq
MIRT2609484	hsa-miR-4465	CLIP-seq
MIRT1297174	hsa-miR-4496	CLIP-seq
MIRT2609485	hsa-miR-4501	CLIP-seq
MIRT2609486	hsa-miR-4504	CLIP-seq
MIRT2609487	hsa-miR-4510	CLIP-seq
MIRT2609488	hsa-miR-4633-5p	CLIP-seq
MIRT2609489	hsa-miR-4639-5p	CLIP-seq
MIRT2609490	hsa-miR-4645-3p	CLIP-seq
MIRT2609491	hsa-miR-4666-3p	CLIP-seq
MIRT1297143	hsa-miR-4666-5p	CLIP-seq
MIRT2609492	hsa-miR-4680-3p	CLIP-seq
MIRT2609493	hsa-miR-4686	CLIP-seq
MIRT2609494	hsa-miR-4715-3p	CLIP-seq
MIRT2609495	hsa-miR-4719	CLIP-seq
MIRT2609496	hsa-miR-4747-5p	CLIP-seq
MIRT2609497	hsa-miR-4760-3p	CLIP-seq
MIRT2609498	hsa-miR-4766-5p	CLIP-seq
MIRT1297145	hsa-miR-4768-3p	CLIP-seq
MIRT2609499	hsa-miR-4781-3p	CLIP-seq
MIRT1297146	hsa-miR-4786-5p	CLIP-seq
MIRT2609500	hsa-miR-4789-5p	CLIP-seq
MIRT2457960	hsa-miR-495	CLIP-seq
MIRT2609501	hsa-miR-500a	CLIP-seq
MIRT2609502	hsa-miR-506	CLIP-seq
MIRT2609503	hsa-miR-5096	CLIP-seq
MIRT2609504	hsa-miR-513a-5p	CLIP-seq
MIRT2609505	hsa-miR-513b	CLIP-seq
MIRT2609506	hsa-miR-542-3p	CLIP-seq
MIRT2609507	hsa-miR-543	CLIP-seq
MIRT2609508	hsa-miR-548l	CLIP-seq
MIRT2609509	hsa-miR-567	CLIP-seq
MIRT2609510	hsa-miR-576-5p	CLIP-seq
MIRT2609511	hsa-miR-577	CLIP-seq
MIRT1297156	hsa-miR-607	CLIP-seq
MIRT1297157	hsa-miR-653	CLIP-seq
MIRT1297158	hsa-miR-655	CLIP-seq
MIRT2609512	hsa-miR-659	CLIP-seq
MIRT2457963	hsa-miR-664	CLIP-seq
MIRT1297159	hsa-miR-665	CLIP-seq
MIRT1297160	hsa-miR-769-5p	CLIP-seq
MIRT2609450	hsa-miR-124	CLIP-seq
MIRT2609455	hsa-miR-1304	CLIP-seq
MIRT2689491	hsa-miR-188-5p	CLIP-seq
MIRT2689492	hsa-miR-1912	CLIP-seq
MIRT2689493	hsa-miR-2054	CLIP-seq
MIRT2609457	hsa-miR-2277-3p	CLIP-seq
MIRT1297127	hsa-miR-23a	CLIP-seq
MIRT1297128	hsa-miR-23b	CLIP-seq
MIRT1297129	hsa-miR-23c	CLIP-seq
MIRT2689494	hsa-miR-27a	CLIP-seq
MIRT2689495	hsa-miR-27b	CLIP-seq
MIRT2609462	hsa-miR-3126-5p	CLIP-seq
MIRT1297130	hsa-miR-3149	CLIP-seq
MIRT2609464	hsa-miR-3152-5p	CLIP-seq
MIRT2609465	hsa-miR-3160-5p	CLIP-seq
MIRT1297168	hsa-miR-3163	CLIP-seq
MIRT1297132	hsa-miR-3180-5p	CLIP-seq
MIRT2689496	hsa-miR-3613-5p	CLIP-seq
MIRT2609468	hsa-miR-3672	CLIP-seq
MIRT2609470	hsa-miR-3714	CLIP-seq
MIRT2457958	hsa-miR-371-5p	CLIP-seq
MIRT2457959	hsa-miR-371b-5p	CLIP-seq
MIRT1297134	hsa-miR-374c	CLIP-seq
MIRT2609474	hsa-miR-3910	CLIP-seq
MIRT2689497	hsa-miR-4257	CLIP-seq
MIRT2609477	hsa-miR-4261	CLIP-seq
MIRT2609478	hsa-miR-4263	CLIP-seq
MIRT2689498	hsa-miR-4301	CLIP-seq
MIRT1297138	hsa-miR-4307	CLIP-seq
MIRT2609480	hsa-miR-4419a	CLIP-seq
MIRT1297173	hsa-miR-4452	CLIP-seq
MIRT2609487	hsa-miR-4510	CLIP-seq
MIRT1297143	hsa-miR-4666-5p	CLIP-seq
MIRT2609492	hsa-miR-4680-3p	CLIP-seq
MIRT1297145	hsa-miR-4768-3p	CLIP-seq
MIRT1297146	hsa-miR-4786-5p	CLIP-seq
MIRT2457960	hsa-miR-495	CLIP-seq
MIRT2609502	hsa-miR-506	CLIP-seq
MIRT2609503	hsa-miR-5096	CLIP-seq
MIRT2609504	hsa-miR-513a-5p	CLIP-seq
MIRT2689499	hsa-miR-548ac	CLIP-seq
MIRT2689500	hsa-miR-548d-3p	CLIP-seq
MIRT1297185	hsa-miR-548u	CLIP-seq
MIRT2689501	hsa-miR-548z	CLIP-seq
MIRT2609510	hsa-miR-576-5p	CLIP-seq
MIRT2609511	hsa-miR-577	CLIP-seq
MIRT1297158	hsa-miR-655	CLIP-seq
MIRT2609512	hsa-miR-659	CLIP-seq
MIRT1297159	hsa-miR-665	CLIP-seq
MIRT1297160	hsa-miR-769-5p	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002357	Process	Defense response to tumor cell	IMP	28409548
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IDA	10675610
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0008143	Function	Poly(A) binding	IBA
GO:0008143	Function	Poly(A) binding	IDA	10675610
GO:0008266	Function	Poly(U) RNA binding	IBA
GO:0008266	Function	Poly(U) RNA binding	IDA	10675610
GO:0010628	Process	Positive regulation of gene expression	IMP	28409548
GO:0010629	Process	Negative regulation of gene expression	IMP	28409548
GO:0035925	Function	MRNA 3'-UTR AU-rich region binding	IDA	10675610
GO:0045727	Process	Positive regulation of translation	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	28409548
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
605786	13427	ENSG00000144642

Q6XE24

Protein name

RNA-binding motif, single-stranded-interacting protein 3

Protein function

Binds poly(A) and poly(U) oligoribonucleotides.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	63 → 128	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	142 → 207	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in fetal brain, fetal lung, fetal liver, heart, brain, placenta, lung, liver, muscle, kidney and pancreas. {ECO:0000269|PubMed:10675610}.

Sequence

MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSK
TNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVA
SLKANGVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSR
GVGFARMESTEKCEVVIQHFNGKYLKTPPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQST
SWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTIQSQDRIMIL
HQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV
DTSNEHAPAYSYQQSKP

Sequence length

437

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (44)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ANEURYSM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM INFECTIOUS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSLEXIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIODONTITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMOOTH SURFACE DENTAL CARIES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (145)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	22993125, 26507309, 30286791, 30367664, 31723601	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	37735116	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19781077, 19833869, 20133711, 22055719, 22957047, 23042786, 24262168, 24840975, 24899262, 24920338, 25239623, 25429138, 26330466, 26895297, 28549443 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	22764223, 22993125, 23022481, 23249733, 23545117, 25009283, 26035390, 26056265, 26391765, 26883171, 29134320, 29701791, 30872628, 31382054, 33495278 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	23545117, 33580145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	19781077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	23046583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30340104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30340104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	22543975, 38103876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	20451256		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone Diseases Metabolic	Bone disease	Pubtator	36077598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19728080, 24840202, 28409548, 30819235		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	19010922, 20370918, 23284704, 27415018, 28191469, 29052531, 31733123, 33845141, 33910421, 35579257, 35705040, 36131924, 36581993, 36722268, 36769184, 39329736, 39509796 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis	Bronchitis	Pubtator	21918681	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26100984, 27542231, 28291789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	14562043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	21480233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30602494, 32572914, 33228611, 33910445, 34076986, 34133325, 34486474, 37234237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12644826, 15205328, 24722255, 25999661, 28038443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35703534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33061812, 33229623, 33456353, 37418046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22016766	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20727170, 26717985, 30279231, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	24960161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35848884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25362645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25362645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	27503288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	24960161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19686745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31064870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23052130, 26222184, 34080453, 36623729, 38041531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24960161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20219773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	25603768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	24103357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36651277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36131924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25528059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32088727, 33391523, 36614043	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	28724967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20727170, 30279231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26234674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26958940, 35945453, 37766459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	24840975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	CTD_human_DG	28553957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	29965897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17586524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	12594214, 21900387, 24462888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	19781077, 23042786, 28663553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	31382054, 33082139, 33495278, 36930291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	18223198, 19833869, 20133711, 22957047, 24840975, 26895297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	32627033	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26100017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28465487, 37833349, 37968257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26100017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	26933087, 28790173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	30665514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	37107676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	37478905	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	28362162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28362162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	32016951	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31400113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30799057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	32060318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12054577, 26346275, 31762817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	11549587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	12054577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	37179431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12644826, 24722255, 25999661, 34636174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	15159028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15880830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	29576851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19728080, 24840202, 28409548, 30819235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22646166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	11549587, 15184870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12644826, 15205328, 24722255, 25999661, 28038443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26717985, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29286182, 31355266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24823909, 29658587, 30078000, 30746571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27902480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14562043, 17927519, 18481990, 20157568, 20305372, 21565971, 23807417, 24516048, 24722255, 25362645, 26046131, 26149387, 27615744, 27940961, 29124478, 29496759, 29658587, 30266754 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	12644826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25362645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19686745		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18454174, 20439467, 30936459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25414259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28493484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	23022481, 33580145	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	23324604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23051967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophies, Limb-Girdle	Limb-Girdle Muscular Dystrophy	BEFREE	26362252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorder Chronic with Eosinophilia	Myeloproliferative disorder	Pubtator	15824116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	9371827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22957092	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25588924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14562043, 18664255, 20186023, 21844183, 24532040, 25588924, 26056275, 26189797, 26438629, 26602816, 26933087, 27771769, 27902480, 28731284, 30078000, 30370480, 30819235 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	36416237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	24103357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23249733, 26455390, 29576851, 32060318, 35197628, 39349456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	19781077, 20133711, 23721326, 24842888, 28912172, 30357366, 30692134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30014466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	37011198	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30664220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21862584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36641761	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36077598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26717985, 31462944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33550985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29286182, 31355266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	35355828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	23051967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15827745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	24262168		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	27503288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	28663553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14654946, 24823909, 29658587, 30078000, 30746571		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20028857, 20110258, 21971048, 26310125, 33542227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37483631	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	37565892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20219773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	20927331, 38103876	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32176034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	22016766, 27941877		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21844183, 25588924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22016766, 27105491, 36675308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	25588924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24085785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20816961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24796666, 27902480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27902480, 33471782, 33589575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	27503288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	31253634, 31754036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29328463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27542231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	33300431, 39329736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33685397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	39392600	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	26819413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RBMS3 (RNA binding motif single stranded interacting protein 3)