Gene Gene information from NCBI Gene database.
Entrez ID 27303
Gene name RNA binding motif single stranded interacting protein 3
Gene symbol RBMS3
Synonyms (NCBI Gene)
-
Chromosome 3
Chromosome location 3p24.1
Summary This gene encodes an RNA-binding protein that belongs to the c-myc gene single-strand binding protein family. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1
miRNA miRNA information provided by mirtarbase database.
353
miRTarBase ID miRNA Experiments Reference
MIRT028524 hsa-miR-30a-5p Proteomics 18668040
MIRT031699 hsa-miR-16-5p Proteomics 18668040
MIRT721515 hsa-miR-1324 HITS-CLIP 19536157
MIRT654314 hsa-miR-877-3p HITS-CLIP 23824327
MIRT654313 hsa-miR-875-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0002357 Process Defense response to tumor cell IMP 28409548
GO:0003676 Function Nucleic acid binding IEA
GO:0003723 Function RNA binding IEA
GO:0003730 Function MRNA 3'-UTR binding IBA
GO:0003730 Function MRNA 3'-UTR binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605786 13427 ENSG00000144642
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q6XE24
Protein name RNA-binding motif, single-stranded-interacting protein 3
Protein function Binds poly(A) and poly(U) oligoribonucleotides.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00076 RRM_1 63 128 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
PF00076 RRM_1 142 207 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in fetal brain, fetal lung, fetal liver, heart, brain, placenta, lung, liver, muscle, kidney and pancreas. {ECO:0000269|PubMed:10675610}.
Sequence
MGKRLDQPQMYPQYTYYYPHYLQTKQSYAPAPHPMAPPSPSTNSSSNNSSNNSSGEQLSK
TNLYIRGLPPGTTDQDLIKLCQPYGKIVSTKAILDKNTNQCKGYGFVDFDSPAAAQKAVA
SLKANGVQ
AQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDANGVSR
GVGFARMESTEKCEVVIQHFNGKYLKT
PPGIPAPSEPLLCKFADGGQKKRQNQSKYTQNG
RPWPREGEAGMALTYDPTAAIQNGFYSSPYSIATNRMIPQTSITPFIAASPVSTYQVQST
SWMPHPPYVMQPTGAVITPTMDHPMSMQPANMMGPLTQQMNHLSLGTTGTIQSQDRIMIL
HQLLCQYMTAAAPMQGTYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAV
DTSNEHAPAYSYQQSKP
Sequence length 437
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
44
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease Alzheimer disease Pubtator 22993125, 26507309, 30286791, 30367664, 31723601 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Alzheimer Disease Alzheimer disease Pubtator 37735116 Inhibit
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 19781077, 19833869, 20133711, 22055719, 22957047, 23042786, 24262168, 24840975, 24899262, 24920338, 25239623, 25429138, 26330466, 26895297, 28549443
View all (6 more)
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Pubtator 22764223, 22993125, 23022481, 23249733, 23545117, 25009283, 26035390, 26056265, 26391765, 26883171, 29134320, 29701791, 30872628, 31382054, 33495278
View all (7 more)
Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic lateral sclerosis 1 Amyotrophic lateral sclerosis Pubtator 23545117, 33580145 Associate
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial Amyotrophic lateral sclerosis BEFREE 19781077
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic Lateral Sclerosis BEFREE 23046583
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 30340104
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 30340104
★☆☆☆☆
Found in Text Mining only
Autism Spectrum Disorder Autism Pubtator 22543975, 38103876 Associate
★☆☆☆☆
Found in Text Mining only