Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2730
Gene name	Glutamate-cysteine ligase modifier subunit
Gene symbol	GCLM
Synonyms (NCBI Gene)	GLCLR
Chromosome	1
Chromosome location	1p22.1
Summary	Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine s

298

Show/Hide all (298)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051314	hsa-miR-15a-5p	CLASH	23622248
MIRT050382	hsa-miR-24-3p	CLASH	23622248
MIRT638687	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT638686	hsa-miR-3155a	HITS-CLIP	23824327
MIRT638685	hsa-miR-3155b	HITS-CLIP	23824327
MIRT638684	hsa-miR-484	HITS-CLIP	23824327
MIRT638683	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT638682	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT638681	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT638680	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT638679	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT638678	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT638677	hsa-miR-6131	HITS-CLIP	23824327
MIRT638676	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT638675	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT638674	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT638673	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT638687	hsa-miR-4781-3p	HITS-CLIP	23824327
MIRT638686	hsa-miR-3155a	HITS-CLIP	23824327
MIRT638685	hsa-miR-3155b	HITS-CLIP	23824327
MIRT638684	hsa-miR-484	HITS-CLIP	23824327
MIRT638683	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT638682	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT638681	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT638680	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT638679	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT638678	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT638677	hsa-miR-6131	HITS-CLIP	23824327
MIRT638676	hsa-miR-6801-5p	HITS-CLIP	23824327
MIRT638675	hsa-miR-5587-5p	HITS-CLIP	23824327
MIRT638674	hsa-miR-6843-3p	HITS-CLIP	23824327
MIRT638673	hsa-miR-6848-3p	HITS-CLIP	23824327
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT1014802	hsa-miR-1224-3p	CLIP-seq
MIRT1014803	hsa-miR-125a-3p	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014806	hsa-miR-1289	CLIP-seq
MIRT1014807	hsa-miR-129-5p	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT1014809	hsa-miR-130a	CLIP-seq
MIRT1014810	hsa-miR-130b	CLIP-seq
MIRT1014811	hsa-miR-143	CLIP-seq
MIRT1014812	hsa-miR-1913	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT1014814	hsa-miR-301a	CLIP-seq
MIRT1014815	hsa-miR-301b	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT1014817	hsa-miR-3155	CLIP-seq
MIRT1014818	hsa-miR-3198	CLIP-seq
MIRT1014819	hsa-miR-324-3p	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT1014821	hsa-miR-3666	CLIP-seq
MIRT1014822	hsa-miR-371-5p	CLIP-seq
MIRT1014823	hsa-miR-3934	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014825	hsa-miR-4294	CLIP-seq
MIRT1014826	hsa-miR-4295	CLIP-seq
MIRT1014827	hsa-miR-4309	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT1014829	hsa-miR-4534	CLIP-seq
MIRT1014830	hsa-miR-454	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT1014833	hsa-miR-4708-5p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT1014835	hsa-miR-4770	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT1014837	hsa-miR-720	CLIP-seq
MIRT1014838	hsa-miR-764	CLIP-seq
MIRT2000458	hsa-miR-1206	CLIP-seq
MIRT2000459	hsa-miR-1208	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT2000460	hsa-miR-1246	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014806	hsa-miR-1289	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT1014811	hsa-miR-143	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT2000462	hsa-miR-190	CLIP-seq
MIRT2000463	hsa-miR-190b	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2000465	hsa-miR-23a	CLIP-seq
MIRT2000466	hsa-miR-23b	CLIP-seq
MIRT2000467	hsa-miR-23c	CLIP-seq
MIRT2000468	hsa-miR-28-3p	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT1014818	hsa-miR-3198	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT2000471	hsa-miR-3942-5p	CLIP-seq
MIRT2000472	hsa-miR-425	CLIP-seq
MIRT2000473	hsa-miR-4257	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014825	hsa-miR-4294	CLIP-seq
MIRT1014827	hsa-miR-4309	CLIP-seq
MIRT2000475	hsa-miR-433	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2000476	hsa-miR-4438	CLIP-seq
MIRT2000477	hsa-miR-4477b	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014829	hsa-miR-4534	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2000479	hsa-miR-4699-3p	CLIP-seq
MIRT2000480	hsa-miR-4703-5p	CLIP-seq
MIRT1014833	hsa-miR-4708-5p	CLIP-seq
MIRT2000481	hsa-miR-4715-3p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT1014835	hsa-miR-4770	CLIP-seq
MIRT2000483	hsa-miR-4797-5p	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000484	hsa-miR-5095	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000486	hsa-miR-580	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq
MIRT1014837	hsa-miR-720	CLIP-seq
MIRT2000488	hsa-miR-935	CLIP-seq
MIRT2000459	hsa-miR-1208	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT1014802	hsa-miR-1224-3p	CLIP-seq
MIRT2233989	hsa-miR-1252	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014806	hsa-miR-1289	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT2233990	hsa-miR-145	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT1014812	hsa-miR-1913	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2233991	hsa-miR-2054	CLIP-seq
MIRT2233992	hsa-miR-2682	CLIP-seq
MIRT2000468	hsa-miR-28-3p	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2233993	hsa-miR-3148	CLIP-seq
MIRT2233994	hsa-miR-3149	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT1014817	hsa-miR-3155	CLIP-seq
MIRT1014818	hsa-miR-3198	CLIP-seq
MIRT1014819	hsa-miR-324-3p	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT1014822	hsa-miR-371-5p	CLIP-seq
MIRT1014823	hsa-miR-3934	CLIP-seq
MIRT2233995	hsa-miR-3973	CLIP-seq
MIRT2233996	hsa-miR-411	CLIP-seq
MIRT2233997	hsa-miR-4258	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014825	hsa-miR-4294	CLIP-seq
MIRT1014827	hsa-miR-4309	CLIP-seq
MIRT2233998	hsa-miR-4328	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2000476	hsa-miR-4438	CLIP-seq
MIRT2233999	hsa-miR-449c	CLIP-seq
MIRT2234000	hsa-miR-4514	CLIP-seq
MIRT2234001	hsa-miR-4524	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014829	hsa-miR-4534	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT2234002	hsa-miR-4692	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2234003	hsa-miR-4700-3p	CLIP-seq
MIRT2234004	hsa-miR-4707-3p	CLIP-seq
MIRT2234005	hsa-miR-4712-5p	CLIP-seq
MIRT2234006	hsa-miR-4716-5p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT2234007	hsa-miR-4735-5p	CLIP-seq
MIRT2234008	hsa-miR-4775	CLIP-seq
MIRT2234009	hsa-miR-4778-3p	CLIP-seq
MIRT2234010	hsa-miR-4794	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000484	hsa-miR-5095	CLIP-seq
MIRT2234011	hsa-miR-512-3p	CLIP-seq
MIRT2234012	hsa-miR-552	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq
MIRT1014837	hsa-miR-720	CLIP-seq
MIRT2234013	hsa-miR-770-5p	CLIP-seq
MIRT2000459	hsa-miR-1208	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000458	hsa-miR-1206	CLIP-seq
MIRT2000471	hsa-miR-3942-5p	CLIP-seq
MIRT2000473	hsa-miR-4257	CLIP-seq
MIRT2429292	hsa-miR-4275	CLIP-seq
MIRT2000475	hsa-miR-433	CLIP-seq
MIRT2000477	hsa-miR-4477b	CLIP-seq
MIRT2000480	hsa-miR-4703-5p	CLIP-seq
MIRT2000483	hsa-miR-4797-5p	CLIP-seq
MIRT2429293	hsa-miR-570	CLIP-seq
MIRT2000486	hsa-miR-580	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT2233989	hsa-miR-1252	CLIP-seq
MIRT1014804	hsa-miR-1273f	CLIP-seq
MIRT2537889	hsa-miR-1279	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT2233990	hsa-miR-145	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT2233992	hsa-miR-2682	CLIP-seq
MIRT2000468	hsa-miR-28-3p	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2233993	hsa-miR-3148	CLIP-seq
MIRT2233994	hsa-miR-3149	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT2537890	hsa-miR-3170	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT2537891	hsa-miR-3941	CLIP-seq
MIRT2233996	hsa-miR-411	CLIP-seq
MIRT2233997	hsa-miR-4258	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2000476	hsa-miR-4438	CLIP-seq
MIRT2233999	hsa-miR-449c	CLIP-seq
MIRT2234000	hsa-miR-4514	CLIP-seq
MIRT2234001	hsa-miR-4524	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT2537892	hsa-miR-4643	CLIP-seq
MIRT2537893	hsa-miR-466	CLIP-seq
MIRT2537894	hsa-miR-4672	CLIP-seq
MIRT2234002	hsa-miR-4692	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2234004	hsa-miR-4707-3p	CLIP-seq
MIRT2234005	hsa-miR-4712-5p	CLIP-seq
MIRT2000481	hsa-miR-4715-3p	CLIP-seq
MIRT2234006	hsa-miR-4716-5p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT2234007	hsa-miR-4735-5p	CLIP-seq
MIRT2537895	hsa-miR-4768-5p	CLIP-seq
MIRT2234008	hsa-miR-4775	CLIP-seq
MIRT2234009	hsa-miR-4778-3p	CLIP-seq
MIRT2537896	hsa-miR-4789-3p	CLIP-seq
MIRT2234010	hsa-miR-4794	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000484	hsa-miR-5095	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq
MIRT2234013	hsa-miR-770-5p	CLIP-seq
MIRT1014801	hsa-miR-122	CLIP-seq
MIRT1014805	hsa-miR-1281	CLIP-seq
MIRT1014808	hsa-miR-1307	CLIP-seq
MIRT2000461	hsa-miR-150	CLIP-seq
MIRT1014813	hsa-miR-1915	CLIP-seq
MIRT2000464	hsa-miR-1976	CLIP-seq
MIRT1014816	hsa-miR-3135b	CLIP-seq
MIRT2233994	hsa-miR-3149	CLIP-seq
MIRT2000469	hsa-miR-3150a-5p	CLIP-seq
MIRT2000470	hsa-miR-3150b-5p	CLIP-seq
MIRT1014820	hsa-miR-3652	CLIP-seq
MIRT2233997	hsa-miR-4258	CLIP-seq
MIRT2000474	hsa-miR-4279	CLIP-seq
MIRT1014824	hsa-miR-4284	CLIP-seq
MIRT1014828	hsa-miR-4430	CLIP-seq
MIRT2234001	hsa-miR-4524	CLIP-seq
MIRT2000478	hsa-miR-4532	CLIP-seq
MIRT1014831	hsa-miR-4638-5p	CLIP-seq
MIRT1014832	hsa-miR-4695-3p	CLIP-seq
MIRT2234004	hsa-miR-4707-3p	CLIP-seq
MIRT2000482	hsa-miR-4722-3p	CLIP-seq
MIRT1014834	hsa-miR-4726-3p	CLIP-seq
MIRT2234007	hsa-miR-4735-5p	CLIP-seq
MIRT2234008	hsa-miR-4775	CLIP-seq
MIRT2234010	hsa-miR-4794	CLIP-seq
MIRT1014836	hsa-miR-498	CLIP-seq
MIRT2000485	hsa-miR-562	CLIP-seq
MIRT2000487	hsa-miR-590-3p	CLIP-seq

Show/Hide all (41)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004357	Function	Glutamate-cysteine ligase activity	IEA
GO:0004357	Function	Glutamate-cysteine ligase activity	IMP	16183645
GO:0005515	Function	Protein binding	IPI	9675072, 28514442, 32296183, 33961781
GO:0005829	Component	Cytosol	NAS	9895302
GO:0005829	Component	Cytosol	TAS
GO:0006534	Process	Cysteine metabolic process	IEA
GO:0006536	Process	Glutamate metabolic process	IDA	9841880, 9895302
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IBA
GO:0006750	Process	Glutathione biosynthetic process	IDA	9675072, 10395918
GO:0006750	Process	Glutathione biosynthetic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IMP	12081989
GO:0006979	Process	Response to oxidative stress	IDA	10395918
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IDA	9895302
GO:0014823	Process	Response to activity	IEA
GO:0017109	Component	Glutamate-cysteine ligase complex	IBA
GO:0017109	Component	Glutamate-cysteine ligase complex	IDA	9675072, 9841880
GO:0017109	Component	Glutamate-cysteine ligase complex	IEA
GO:0035226	Function	Glutamate-cysteine ligase catalytic subunit binding	IBA
GO:0035226	Function	Glutamate-cysteine ligase catalytic subunit binding	IEA
GO:0035226	Function	Glutamate-cysteine ligase catalytic subunit binding	IPI	9675072, 9841880
GO:0035729	Process	Cellular response to hepatocyte growth factor stimulus	IEA
GO:0035733	Process	Hepatic stellate cell activation	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEA
GO:0044752	Process	Response to human chorionic gonadotropin	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0051409	Process	Response to nitrosative stress	IEA
GO:0051900	Process	Regulation of mitochondrial depolarization	IEA
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0071372	Process	Cellular response to follicle-stimulating hormone stimulus	IEA
GO:0097069	Process	Cellular response to thyroxine stimulus	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IMP	12975258
GO:1990609	Function	Glutamate-cysteine ligase regulator activity	IBA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:2001237	Process	Negative regulation of extrinsic apoptotic signaling pathway	IEA

MIM	HGNC	e!Ensembl
601176	4312	ENSG00000023909

P48507

Protein name

Glutamate--cysteine ligase regulatory subunit (GCS light chain) (Gamma-ECS regulatory subunit) (Gamma-glutamylcysteine synthetase regulatory subunit) (Glutamate--cysteine ligase modifier subunit)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00248	Aldo_ket_red	70 → 241	Aldo/keto reductase family	Domain

Tissue specificity

TISSUE SPECIFICITY: In all tissues examined. Highest levels in skeletal muscle.

Sequence

MGTDSRAAKALLARARTLHLQTGNLLNWGRLRKKCPSTHSEELHDCIQKTLNEWSSQINP
DLVREFPDVLECTVSHAVEKINPDEREEMKVSAKLFIVESNSSSSTRSAVDMACSVLGVA
QLDSVIIASPPIEDGVNLSLEHLQPYWEELENLVQSKKIVAIGTSDLDKTQLEQLYQWAQ
VKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAH
EWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS

Sequence length

274

Interactions

View interactions

	KEGG		Reactome
	Cysteine and methionine metabolism Glutathione metabolism Metabolic pathways Biosynthesis of cofactors Ferroptosis		Glutathione synthesis and recycling Defective GCLC causes Hemolytic anemia due to gamma-glutamylcysteine synthetase deficiency (HAGGSD)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BERYLLIOSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial infarction, susceptibility to	risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (60)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15254739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11774239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11774239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	31271759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29307609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hemolytic	Anemia	BEFREE	10515893, 10733484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19126404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	17643973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19126404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29440447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11774239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35841206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11911273, 9245699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	7671249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23129588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	17331133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	10802223, 20732852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11097346, 11500053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11774239, 8705999, 9679568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	LHGDN	12975258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24933031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	38287255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	34722766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	9626582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	9626582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	9345268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28755973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Vulgaris	Ichthyosis vulgaris	Pubtator	20664557	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Volvulus	Intestinal Volvulus	BEFREE	11163433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16239001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29549912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	14532974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	9841137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11911273, 9245699, 9569044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	7671249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11097346, 11687904, 25620030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11097346, 11500053, 11687904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	9495245, 9841137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	23152058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mutilating keratoderma	Mutilating Keratoderma	BEFREE	10940652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12081989, 21504558		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12081989		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12081989, 12975258		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28757675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	28757675	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24802641, 7671249, 8705999, 9569044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28681934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16012725		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	7671249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29852184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	1355406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	16909399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18449862, 18991850, 19455074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	18991850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16012725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15254739, 9268987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31351176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29440447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29440447	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34418989, 37108769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GCLM (glutamate-cysteine ligase modifier subunit)