RND1 (Rho family GTPase 1)

Gene

• Entrez ID: 27289
• Gene name: Rho family GTPase 1
• Gene symbol: RND1
• Synonyms (NCBI Gene): ARHS, RHO6, RHOS
• Chromosome: 12
• Chromosome location: 12q13.12
• Summary: This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to c

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021868	hsa-miR-128-3p	Microarray	17612493
MIRT437383	hsa-miR-199a-5p	Luciferase reporter assay	23201090
MIRT437383	hsa-miR-199a-5p	Luciferase reporter assay	23201090
MIRT1308799	hsa-miR-127-5p	CLIP-seq
MIRT1308800	hsa-miR-2467-5p	CLIP-seq
MIRT1308801	hsa-miR-3188	CLIP-seq
MIRT1308802	hsa-miR-3975	CLIP-seq
MIRT1308803	hsa-miR-410	CLIP-seq
MIRT1308804	hsa-miR-4316	CLIP-seq
MIRT1308805	hsa-miR-4710	CLIP-seq
MIRT1308806	hsa-miR-4781-5p	CLIP-seq
MIRT1308807	hsa-miR-485-5p	CLIP-seq
MIRT1308808	hsa-miR-493	CLIP-seq
MIRT1308809	hsa-miR-494	CLIP-seq
MIRT1308810	hsa-miR-516b	CLIP-seq
MIRT1308811	hsa-miR-518a-5p	CLIP-seq
MIRT1308812	hsa-miR-527	CLIP-seq
MIRT2316224	hsa-miR-1266	CLIP-seq
MIRT2316225	hsa-miR-24	CLIP-seq
MIRT2316226	hsa-miR-4270	CLIP-seq
MIRT2316227	hsa-miR-4437	CLIP-seq
MIRT2316228	hsa-miR-4441	CLIP-seq
MIRT2316229	hsa-miR-4518	CLIP-seq
MIRT2393786	hsa-miR-29a	CLIP-seq
MIRT2393787	hsa-miR-29b	CLIP-seq
MIRT2393788	hsa-miR-29c	CLIP-seq
MIRT2393789	hsa-miR-3065-3p	CLIP-seq
MIRT2458309	hsa-miR-103a	CLIP-seq
MIRT2458310	hsa-miR-107	CLIP-seq
MIRT2458311	hsa-miR-1184	CLIP-seq
MIRT2458312	hsa-miR-1913	CLIP-seq
MIRT2393786	hsa-miR-29a	CLIP-seq
MIRT2393787	hsa-miR-29b	CLIP-seq
MIRT2393788	hsa-miR-29c	CLIP-seq
MIRT2393789	hsa-miR-3065-3p	CLIP-seq
MIRT2458313	hsa-miR-324-3p	CLIP-seq
MIRT2458314	hsa-miR-4749-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	NAS	9531558, 11095956
GO:0005102	Function	Signaling receptor binding	IPI	19843518
GO:0005515	Function	Protein binding	IPI	10664463, 12730235, 14732713, 25531777, 29040270, 32296183
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IDA	9531558
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IDA	9531558, 11095956
GO:0007162	Process	Negative regulation of cell adhesion	IDA	9531558
GO:0007165	Process	Signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0016322	Process	Neuron remodeling	IDA	11095956
GO:0019901	Function	Protein kinase binding	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA

Other IDs

• MIM: 609038
• HGNC: 18314
• e!Ensembl: ENSG00000172602

Protein

• UniProt ID: Q92730
• Protein name: Rho-related GTP-binding protein Rho6 (Rho family GTPase 1) (Rnd1)
• Protein function: Lacks intrinsic GTPase activity. Has a low affinity for GDP, and constitutively binds GTP. Controls rearrangements of the actin cytoskeleton. Induces the Rac-dependent neuritic process formation in part by disruption of the cortical actin filame
• PDB: 2CLS, 2REX, 3Q3J
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	15 → 188	Ras family	Domain

• Tissue specificity: TISSUE SPECIFICITY: Mostly expressed in brain and liver.
• Sequence:

  MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQR
  VELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRV
  LLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIF
  RTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

• Sequence length: 232

Pathways

KEGG:

Axon guidance

Reactome:

Sema4D mediated inhibition of cell attachment and migration
Sema4D induced cell migration and growth-cone collapse

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BONE FRACTURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	26856603	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25531777		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30333910		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30333910		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27770342, 29706627		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25531777		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27770342, 29706627		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25531777		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26004609	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31344837		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	25531777		★☆☆☆☆ Found in Text Mining only