Gene Gene information from NCBI Gene database.
Entrez ID 27287
Gene name VENT homeobox
Gene symbol VENTX
Synonyms (NCBI Gene)
HPX42BNA88AVENTX2
Chromosome 10
Chromosome location 10q26.3
Summary This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene
miRNA miRNA information provided by mirtarbase database.
301
miRTarBase ID miRNA Experiments Reference
MIRT707405 hsa-miR-6074 HITS-CLIP 21572407
MIRT517563 hsa-miR-1277-5p HITS-CLIP 21572407
MIRT517562 hsa-miR-8485 HITS-CLIP 21572407
MIRT517561 hsa-miR-329-3p HITS-CLIP 21572407
MIRT517560 hsa-miR-362-3p HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
17
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IEA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific ISA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607158 13639 ENSG00000151650
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95231
Protein name Homeobox protein VENTX (VENT homeobox homolog) (VENT-like homeobox protein 2)
Protein function May be involved in ventralization.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00046 Homeodomain 92 148 Homeodomain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in bone marrow of patients recovering from chemotherapy. Also expressed in an erythroleukemia cell line. {ECO:0000269|PubMed:11549314}.
Sequence
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQA
VSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLE
RKRLAREMQLSEVQIKTWFQNRRMKHKR
QMQDPQLHSPFSGSLHAPPAFYSTSSGLANGL
QLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPA
LSTGPRGLCAMPQTGDAF
Sequence length 258
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Senescence-Associated Secretory Phenotype (SASP)
Transcriptional Regulation by VENTX
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ESOPHAGEAL SQUAMOUS CELL CARCINOMA CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Erythroblastic Leukemia Erythroblastic Leukemia BEFREE 27888632
★☆☆☆☆
Found in Text Mining only
Acute erythroleukemia Erythroleukemia BEFREE 27888632
★☆☆☆☆
Found in Text Mining only
Carcinoma Pancreatic Ductal Pancreatic ductal carcinoma Pubtator 32573491 Associate
★☆☆☆☆
Found in Text Mining only
Hematopoietic Neoplasms Hematopoietic Neoplasms BEFREE 20028861
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory Bowel Disease BEFREE 24706756
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory bowel disease Pubtator 24706756 Stimulate
★☆☆☆☆
Found in Text Mining only
Leukemia Leukemia Pubtator 20833819 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Lymphoid Lymphoid leukemia Pubtator 21325273 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 20833819, 31825998 Associate
★☆☆☆☆
Found in Text Mining only
Leukemia, Myelocytic, Acute Leukemia BEFREE 20833819, 27888632
★☆☆☆☆
Found in Text Mining only