TINAG (tubulointerstitial nephritis antigen)

Gene

• Entrez ID: 27283
• Gene name: Tubulointerstitial nephritis antigen
• Gene symbol: TINAG
• Synonyms (NCBI Gene): TIN-AG
• Chromosome: 6
• Chromosome location: 6p12.1
• Summary: This gene encodes a glycoprotein that is restricted within the kidney to the basement membranes underlying the epithelium of Bowman`s capsule and proximal and distal tubules. Autoantibodies against this protein are found in sera of patients with tubuloint

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT2349249	hsa-miR-1252	CLIP-seq
MIRT2349250	hsa-miR-4517	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	TAS	10652240
GO:0004197	Function	Cysteine-type endopeptidase activity	TAS	10652240
GO:0005576	Component	Extracellular region	IEA
GO:0005604	Component	Basement membrane	IDA	1762287
GO:0005604	Component	Basement membrane	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005764	Component	Lysosome	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0007155	Process	Cell adhesion	IDA	8770961
GO:0007155	Process	Cell adhesion	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA

Other IDs

• MIM: 606749
• HGNC: 14599
• e!Ensembl: ENSG00000137251

Protein

• UniProt ID: Q9UJW2
• Protein name: Tubulointerstitial nephritis antigen (TIN-Ag)
• Protein function: Mediates adhesion of proximal tubule epithelial cells via integrins alpha3-beta1 and alphaV-beta3. This is a non catalytic peptidase C1 family protein.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01033	Somatomedin_B	61 → 105	Somatomedin B domain	Family
  PF00112	Peptidase_C1	227 → 467	Papain family cysteine protease	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the kidney cortex, small intestine and cornea. {ECO:0000269|PubMed:10652240, ECO:0000269|PubMed:10752525, ECO:0000269|PubMed:1762287}.
• Sequence:

  MWTGYKILIFSYLTTEIWMEKQYLSQREVDLEAYFTRNHTVLQGTRFKRAIFQGQYCRNF
  GCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKSFCREEKEWPPHTQPWYPEGC
  FKDGQHYEEGSVIKENCNSCTCSGQQWKCSQHVCLVRSELIEQVNKGDYGWTAQNYSQFW
  GMTLEDGFKFRLGTLPPSPMLLSMNEMTASLPATTDLPEFFVASYKWPGWTHGPLDQKNC
  AASWAFSTASVAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG
  LVSHACYPLFKDQNATNNGCAMASRSDGRGKRHATKPCPNNVEKSNRIYQCSPPYRVSSN
  ETEIMKEIMQNGPVQAIMQVREDFFHYKTGIYRHVTSTNKESEKYRKLQTHAVKLTGWGT
  LRGAQGQKEKFWIAANSWGKSWGENGYFRILRGVNESDIEKLIIAAWGQLTSSDEP

• Sequence length: 476

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM INFECTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29991125	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	20157734		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	20157734		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	19634143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	29991125	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	20157734		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29991125		★☆☆☆☆ Found in Text Mining only
Nephritis, Interstitial	Nephritis	BEFREE	10652240		★☆☆☆☆ Found in Text Mining only
Nephritis, Tubulointerstitial	Nephritis	BEFREE	10652240		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	10652240		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 1	Nephronophthisis	BEFREE	10652240		★☆☆☆☆ Found in Text Mining only
Nephronophthisis, familial juvenile	Nephronophthisis	BEFREE	10652240		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	19634143		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30747226	Associate	★☆☆☆☆ Found in Text Mining only