Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27250
Gene name	Programmed cell death 4
Gene symbol	PDCD4
Synonyms (NCBI Gene)	H731
Chromosome	10
Chromosome location	10q25.2
Summary	This gene is a tumor suppressor and encodes a protein that binds to the eukaryotic translation initiation factor 4A1 and inhibits its function by preventing RNA binding. Alternative splicing results in multiple transcript variants. [provided by RefSeq, De

971

Show/Hide all (971)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestren blot	17968323
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	18372920
MIRT003054	hsa-miR-21-5p	qRT-PCRWestern blot	19906824
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	18270520
MIRT003054	hsa-miR-21-5p	Western blotNorthern blot	19013014
MIRT003054	hsa-miR-21-5p	qRT-PCR	19013014
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	19013014
MIRT000810	hsa-miR-15a-5p	qRT-PCR	18362358
MIRT000809	hsa-miR-16-5p	qRT-PCR	18362358
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	18850008
MIRT003054	hsa-miR-21-5p	Review	19935707
MIRT003054	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayWestern blot	20143188
MIRT003054	hsa-miR-21-5p	qRT-PCRLuciferase reporter assayWestern blot	20143188
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	18850008
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	19133651
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	19419954
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	18850008
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	17968323
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	18372920
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	18270520
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	19836969
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRWestern blot	19264808
MIRT003054	hsa-miR-21-5p	Review	19815577
MIRT003054	hsa-miR-21-5p	Review	20130964
MIRT003054	hsa-miR-21-5p	Review	20029422
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	20056717
MIRT003054	hsa-miR-21-5p	24A	20831814
MIRT003054	hsa-miR-21-5p	GFP reporter assayNorthern blotqRT-PCRWestern blotASO assay	19641183
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayqRT-PCRQuantitative proteomic approach	19253296
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayqRT-PCR	18829576
MIRT003054	hsa-miR-21-5p	ImmunoblotImmunofluorescenceLuciferase reporter assayqRT-PCR	20533548
MIRT003054	hsa-miR-21-5p	MicroarrayNorthern blot	16966691
MIRT003054	hsa-miR-21-5p	TE10	19276261
MIRT004005	hsa-miR-200a-3p	Microarray	17875710
MIRT003054	hsa-miR-21-5p	Western blot	19509156
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	19682430
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	19682430
MIRT003054	hsa-miR-21-5p	Western blot	19672202
MIRT002785	hsa-miR-1-3p	Microarray	15685193
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCRWestern blot	20602797
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCRWestern blot	20602797
MIRT003054	hsa-miR-21-5p	ImmunohistochemistryqRT-PCRWestern blot	20978511
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	21469086
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	21469086
MIRT003054	hsa-miR-21-5p	Immunohistochemistry	19473551
MIRT003054	hsa-miR-21-5p	Immunohistochemistry	19473551
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	20219857
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	21469086
MIRT003054	hsa-miR-21-5p	Immunohistochemistry	19473551
MIRT003054	hsa-miR-21-5p	Immunohistochemistry	19473551
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	20219857
MIRT006699	hsa-miR-499a-5p	Luciferase reporter assayqRT-PCRWestern blot	21934092
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT007155	hsa-miR-182-5p	Luciferase reporter assayqRT-PCRWestern blot	23296900
MIRT019086	hsa-miR-335-5p	Microarray	18185580
MIRT021056	hsa-miR-155-5p	Other	20584899
MIRT002785	hsa-miR-1-3p	Microarray	18668037
MIRT002785	hsa-miR-1-3p	Microarray	15685193
MIRT026027	hsa-miR-196a-5p	Sequencing	20371350
MIRT003054	hsa-miR-21-5p	Reporter assay	17968323
MIRT003054	hsa-miR-21-5p	Reporter assay;Other	18270520
MIRT003054	hsa-miR-21-5p	Sequencing	20371350
MIRT003054	hsa-miR-21-5p	Microarray	18591254
MIRT003054	hsa-miR-21-5p	Reporter assay	18372920
MIRT003054	hsa-miR-21-5p	Reporter assay	18270520
MIRT003054	hsa-miR-21-5p	Reporter assay	17991735
MIRT003054	hsa-miR-21-5p	Reporter assay	17968323
MIRT048135	hsa-miR-197-3p	CLASH	23622248
MIRT003054	hsa-miR-21-5p	Western blot	22766763
MIRT053003	hsa-miR-10b-5p	Western blot	22766763
MIRT003054	hsa-miR-21-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	23548551
MIRT003054	hsa-miR-21-5p	In situ hybridizationqRT-PCR	20372781
MIRT003054	hsa-miR-21-5p	ImmunohistochemistryqRT-PCRWestern blot	22212233
MIRT003054	hsa-miR-21-5p	qRT-PCRWestern blot	24659669
MIRT005547	hsa-miR-183-5p	qRT-PCRWestern blot	25356105
MIRT003054	hsa-miR-21-5p	qRT-PCRWestern blot	23824073
MIRT437779	mmu-miR-21a-5p	qRT-PCR	25520758
MIRT437779	mmu-miR-21a-5p	qRT-PCR	25520758
MIRT003054	hsa-miR-21-5p	ImmunohistochemistryqRT-PCRWestern blot	23417858
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	23708209
MIRT003054	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	23827854
MIRT003054	hsa-miR-21-5p	ImmunohistochemistryWestern blot	24732841
MIRT003054	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	23811941
MIRT003054	hsa-miR-21-5p	FlowqRT-PCRWestern blot	26028073
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCR	25211657
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCR	25211657
MIRT007155	hsa-miR-182-5p	Luciferase reporter assay	23877371
MIRT007155	hsa-miR-182-5p	Luciferase reporter assay	23877371
MIRT003054	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	23827854
MIRT003054	hsa-miR-21-5p	ImmunohistochemistryWestern blot	24732841
MIRT003054	hsa-miR-21-5p	ImmunofluorescenceImmunohistochemistryqRT-PCRWestern blot	23811941
MIRT003054	hsa-miR-21-5p	FlowqRT-PCRWestern blot	26028073
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCR	25211657
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCR	25211657
MIRT007155	hsa-miR-182-5p	Luciferase reporter assay	23877371
MIRT007155	hsa-miR-182-5p	Luciferase reporter assay	23877371
MIRT678650	hsa-miR-562	HITS-CLIP	23824327
MIRT678649	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT678648	hsa-miR-5697	HITS-CLIP	23824327
MIRT678647	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT678646	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT678645	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT678644	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT678643	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678642	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT678641	hsa-miR-1976	HITS-CLIP	23824327
MIRT678640	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT678639	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT678638	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678637	hsa-miR-4279	HITS-CLIP	23824327
MIRT678636	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT566481	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT055360	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT055363	hsa-miR-3662	PAR-CLIP	20371350
MIRT055361	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT566480	hsa-miR-4464	PAR-CLIP	20371350
MIRT566479	hsa-miR-4748	PAR-CLIP	20371350
MIRT566478	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT055362	hsa-miR-3163	PAR-CLIP	20371350
MIRT566477	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT566476	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT055365	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT003054	hsa-miR-21-5p	PAR-CLIP	20371350
MIRT055366	hsa-miR-590-5p	PAR-CLIP	20371350
MIRT055367	hsa-miR-548m	PAR-CLIP	20371350
MIRT329826	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT055372	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT329824	hsa-miR-655-5p	PAR-CLIP	20371350
MIRT055368	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT555730	hsa-miR-520d-5p	PAR-CLIP	20371350
MIRT555729	hsa-miR-524-5p	PAR-CLIP	20371350
MIRT055373	hsa-miR-5579-3p	PAR-CLIP	20371350
MIRT055374	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT055371	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT055369	hsa-miR-3658	PAR-CLIP	20371350
MIRT003054	hsa-miR-21-5p	PAR-CLIP	21572407
MIRT055366	hsa-miR-590-5p	PAR-CLIP	21572407
MIRT055367	hsa-miR-548m	PAR-CLIP	21572407
MIRT329826	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT055372	hsa-miR-5197-3p	PAR-CLIP	21572407
MIRT329824	hsa-miR-655-5p	PAR-CLIP	21572407
MIRT055368	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT555730	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555729	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT055373	hsa-miR-5579-3p	PAR-CLIP	21572407
MIRT055374	hsa-miR-6509-3p	PAR-CLIP	21572407
MIRT055371	hsa-miR-4436b-5p	PAR-CLIP	21572407
MIRT055369	hsa-miR-3658	PAR-CLIP	21572407
MIRT021056	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT021056	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT000810	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT125922	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT000809	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT125925	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT003054	hsa-miR-21-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	26367487
MIRT125926	hsa-miR-320a	Luciferase reporter assayqRT-PCRWestern blot	27279541
MIRT003054	hsa-miR-21-5p	Luciferase reporter assay	26864640
MIRT731482	hsa-miR-93-3p	Luciferase reporter assay	27021515
MIRT731482	hsa-miR-93-3p	Luciferase reporter assay	27021515
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	25994220
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	25994220
MIRT003054	hsa-miR-21-5p	FACSLuciferase reporter assayqRT-PCRWestern blot	26387848
MIRT003054	hsa-miR-21-5p	qRT-PCRWestern blot	26320576
MIRT731769	hsa-miR-202-3p	Luciferase reporter assayqRT-PCRWestern blot	26276504
MIRT731769	hsa-miR-202-3p	Luciferase reporter assayqRT-PCRWestern blot	26276504
MIRT735894	hsa-miR-21-3p	Western blot	28123598
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCRWestern blot	27476679
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayqRT-PCRWestern blot	27476679
MIRT003054	hsa-miR-21-5p	Western blot	28069514
MIRT003054	hsa-miR-21-5p	ChIP-seqImmunofluorescenceImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27876813
MIRT005547	hsa-miR-183-5p	Luciferase reporter assay	26063221
MIRT005547	hsa-miR-183-5p	Luciferase reporter assay	26063221
MIRT004005	hsa-miR-200a-3p	Luciferase reporter assayNext Generation Sequencing (NGS)RISC-IPqRT-PCRWestern blot	27734462
MIRT004005	hsa-miR-200a-3p	Luciferase reporter assayNext Generation Sequencing (NGS)RISC-IPqRT-PCRWestern blot	27734462
MIRT735894	hsa-miR-21-3p	ImmunofluorescenceqRT-PCRWestern blot	26595526
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blot	27240294
MIRT005547	hsa-miR-183-5p	ELISAFlow cytometryLuciferase reporter assayqRT-PCRWestern blotting	34180760
MIRT732681	hsa-miR-212-3p	Luciferase reporter assayqRT-PCRWestern blotting	32474742
MIRT003054	hsa-miR-21-5p	ELISARNA-seqqRT-PCRWestern blotting	33391543
MIRT000809	hsa-miR-16-5p	Immunohistochemistry (IHC)qRT-PCRWestern blotting	32775445
MIRT003054	hsa-miR-21-5p	qRT-PCRWestern blotting	33042450
MIRT734202	hsa-miR-155-3p	Luciferase reporter assayqRT-PCRWestern blotting	31851829
MIRT734202	hsa-miR-155-3p	Luciferase reporter assayqRT-PCRWestern blotting	31851829
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blottingqRT-PCR	33594315
MIRT735277	hsa-miR-519d-3p	Western blottingqRT-PCR	32432496
MIRT735894	hsa-miR-21-3p	Immunohistochemistry (IHC)qRT-PCR	31886257
MIRT735894	hsa-miR-21-3p	MicroarrayqRT-PCR	31611956
MIRT735894	hsa-miR-21-3p	Microarray	33241835
MIRT736505	hsa-miR-20b-3p	Microarray	32902755
MIRT734202	hsa-miR-155-3p	Microarray	32902755
MIRT734202	hsa-miR-155-3p	Microarray	32902755
MIRT736609	hsa-miR-135b-3p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	33089961
MIRT003054	hsa-miR-21-5p	Luciferase reporter assayWestern blottingqRT-PCR	31602231
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)RNA-seqqRT-PCRFlow cytometry	33078826
MIRT678650	hsa-miR-562	HITS-CLIP	23824327
MIRT678649	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT678648	hsa-miR-5697	HITS-CLIP	23824327
MIRT678647	hsa-miR-6814-5p	HITS-CLIP	23824327
MIRT678646	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT678645	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT678644	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT678643	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT678642	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT678641	hsa-miR-1976	HITS-CLIP	23824327
MIRT678640	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT678639	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT678638	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT678637	hsa-miR-4279	HITS-CLIP	23824327
MIRT678636	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT055348	hsa-miR-548ae-3p	HITS-CLIP	23824327
MIRT055349	hsa-miR-548ah-3p	HITS-CLIP	23824327
MIRT055350	hsa-miR-548aj-3p	HITS-CLIP	23824327
MIRT055351	hsa-miR-548am-3p	HITS-CLIP	23824327
MIRT055352	hsa-miR-548aq-3p	HITS-CLIP	23824327
MIRT055342	hsa-miR-548j-3p	HITS-CLIP	23824327
MIRT055345	hsa-miR-548x-3p	HITS-CLIP	23824327
MIRT055354	hsa-miR-5582-3p	HITS-CLIP	23824327
MIRT125944	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT611738	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT611737	hsa-miR-218-5p	HITS-CLIP	23824327
MIRT566481	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT055360	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT055363	hsa-miR-3662	PAR-CLIP	20371350
MIRT055361	hsa-miR-513b-3p	PAR-CLIP	20371350
MIRT566480	hsa-miR-4464	PAR-CLIP	20371350
MIRT566479	hsa-miR-4748	PAR-CLIP	20371350
MIRT566478	hsa-miR-329-5p	PAR-CLIP	20371350
MIRT055362	hsa-miR-3163	PAR-CLIP	20371350
MIRT566477	hsa-miR-3127-3p	PAR-CLIP	20371350
MIRT566476	hsa-miR-6756-3p	PAR-CLIP	20371350
MIRT055365	hsa-miR-6826-3p	PAR-CLIP	20371350
MIRT003054	hsa-miR-21-5p	PAR-CLIP	20371350
MIRT055366	hsa-miR-590-5p	PAR-CLIP	20371350
MIRT055367	hsa-miR-548m	PAR-CLIP	20371350
MIRT329826	hsa-miR-5003-3p	PAR-CLIP	20371350
MIRT055372	hsa-miR-5197-3p	PAR-CLIP	20371350
MIRT329824	hsa-miR-655-5p	PAR-CLIP	20371350
MIRT055368	hsa-miR-3653-3p	PAR-CLIP	20371350
MIRT555730	hsa-miR-520d-5p	PAR-CLIP	20371350
MIRT555729	hsa-miR-524-5p	PAR-CLIP	20371350
MIRT055373	hsa-miR-5579-3p	PAR-CLIP	20371350
MIRT055374	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT055371	hsa-miR-4436b-5p	PAR-CLIP	20371350
MIRT055369	hsa-miR-3658	PAR-CLIP	20371350
MIRT003054	hsa-miR-21-5p	PAR-CLIP	21572407
MIRT055366	hsa-miR-590-5p	PAR-CLIP	21572407
MIRT055367	hsa-miR-548m	PAR-CLIP	21572407
MIRT329826	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT055372	hsa-miR-5197-3p	PAR-CLIP	21572407
MIRT329824	hsa-miR-655-5p	PAR-CLIP	21572407
MIRT055368	hsa-miR-3653-3p	PAR-CLIP	21572407
MIRT555730	hsa-miR-520d-5p	PAR-CLIP	21572407
MIRT555729	hsa-miR-524-5p	PAR-CLIP	21572407
MIRT055373	hsa-miR-5579-3p	PAR-CLIP	21572407
MIRT055374	hsa-miR-6509-3p	PAR-CLIP	21572407
MIRT055371	hsa-miR-4436b-5p	PAR-CLIP	21572407
MIRT055369	hsa-miR-3658	PAR-CLIP	21572407
MIRT003054	hsa-miR-21-5p	Western blottingqRT-PCR	34608109
MIRT678643	hsa-miR-150-5p	Luciferase reporter assayWestern blottingqRT-PCR	35811521
MIRT005547	hsa-miR-183-5p	Luciferase reporter assayWestern blottingqRT-PCRin vitro cullelar assaysFlow cytometryELISA	34180760
MIRT055366	hsa-miR-590-5p	Luciferase reporter assayWestern blottingqRT-PCRImmunoprecipitaion (IP)	35640631
MIRT003054	hsa-miR-21-5p	qRT-PCR	36071352
MIRT1219300	hsa-let-7a	CLIP-seq
MIRT1219301	hsa-let-7b	CLIP-seq
MIRT1219302	hsa-let-7c	CLIP-seq
MIRT1219303	hsa-let-7d	CLIP-seq
MIRT1219304	hsa-let-7e	CLIP-seq
MIRT1219305	hsa-let-7f	CLIP-seq
MIRT1219306	hsa-let-7g	CLIP-seq
MIRT1219307	hsa-let-7i	CLIP-seq
MIRT1219308	hsa-miR-106a	CLIP-seq
MIRT1219309	hsa-miR-106b	CLIP-seq
MIRT1219310	hsa-miR-1224-3p	CLIP-seq
MIRT1219311	hsa-miR-1234	CLIP-seq
MIRT1219312	hsa-miR-1264	CLIP-seq
MIRT1219313	hsa-miR-1271	CLIP-seq
MIRT1219314	hsa-miR-141	CLIP-seq
MIRT1219315	hsa-miR-144	CLIP-seq
MIRT1219316	hsa-miR-145	CLIP-seq
MIRT1219317	hsa-miR-1470	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT1219319	hsa-miR-15a	CLIP-seq
MIRT1219320	hsa-miR-15b	CLIP-seq
MIRT1219321	hsa-miR-16	CLIP-seq
MIRT1219322	hsa-miR-17	CLIP-seq
MIRT1219323	hsa-miR-182	CLIP-seq
MIRT1219324	hsa-miR-183	CLIP-seq
MIRT1219325	hsa-miR-186	CLIP-seq
MIRT1219326	hsa-miR-193a-5p	CLIP-seq
MIRT1219327	hsa-miR-194	CLIP-seq
MIRT1219328	hsa-miR-195	CLIP-seq
MIRT1219329	hsa-miR-200a	CLIP-seq
MIRT1219330	hsa-miR-202	CLIP-seq
MIRT1219331	hsa-miR-208a	CLIP-seq
MIRT1219332	hsa-miR-208b	CLIP-seq
MIRT1219333	hsa-miR-20a	CLIP-seq
MIRT1219334	hsa-miR-20b	CLIP-seq
MIRT1219335	hsa-miR-21	CLIP-seq
MIRT1219336	hsa-miR-2115	CLIP-seq
MIRT1219337	hsa-miR-302a	CLIP-seq
MIRT1219338	hsa-miR-302b	CLIP-seq
MIRT1219339	hsa-miR-302c	CLIP-seq
MIRT1219340	hsa-miR-302d	CLIP-seq
MIRT1219341	hsa-miR-302e	CLIP-seq
MIRT1219342	hsa-miR-3133	CLIP-seq
MIRT1219343	hsa-miR-3170	CLIP-seq
MIRT1219344	hsa-miR-3180-5p	CLIP-seq
MIRT1219345	hsa-miR-320e	CLIP-seq
MIRT1219346	hsa-miR-323-3p	CLIP-seq
MIRT1219347	hsa-miR-326	CLIP-seq
MIRT1219348	hsa-miR-330-5p	CLIP-seq
MIRT1219349	hsa-miR-331-5p	CLIP-seq
MIRT1219350	hsa-miR-340	CLIP-seq
MIRT1219351	hsa-miR-34a	CLIP-seq
MIRT1219352	hsa-miR-34c-5p	CLIP-seq
MIRT1219353	hsa-miR-3653	CLIP-seq
MIRT1219354	hsa-miR-3667-5p	CLIP-seq
MIRT1219355	hsa-miR-3674	CLIP-seq
MIRT1219356	hsa-miR-372	CLIP-seq
MIRT1219357	hsa-miR-373	CLIP-seq
MIRT1219358	hsa-miR-3976	CLIP-seq
MIRT1219359	hsa-miR-3978	CLIP-seq
MIRT1219360	hsa-miR-410	CLIP-seq
MIRT1219361	hsa-miR-421	CLIP-seq
MIRT1219362	hsa-miR-424	CLIP-seq
MIRT1219363	hsa-miR-4292	CLIP-seq
MIRT1219364	hsa-miR-4308	CLIP-seq
MIRT1219365	hsa-miR-4312	CLIP-seq
MIRT1219366	hsa-miR-4328	CLIP-seq
MIRT1219367	hsa-miR-4438	CLIP-seq
MIRT1219368	hsa-miR-4454	CLIP-seq
MIRT1219369	hsa-miR-4458	CLIP-seq
MIRT1219370	hsa-miR-449a	CLIP-seq
MIRT1219371	hsa-miR-449b	CLIP-seq
MIRT1219372	hsa-miR-4500	CLIP-seq
MIRT1219373	hsa-miR-4517	CLIP-seq
MIRT1219374	hsa-miR-4524	CLIP-seq
MIRT1219375	hsa-miR-4640-3p	CLIP-seq
MIRT1219376	hsa-miR-4641	CLIP-seq
MIRT1219377	hsa-miR-4652-3p	CLIP-seq
MIRT1219378	hsa-miR-4659a-3p	CLIP-seq
MIRT1219379	hsa-miR-4659b-3p	CLIP-seq
MIRT1219380	hsa-miR-4667-3p	CLIP-seq
MIRT1219381	hsa-miR-4709-5p	CLIP-seq
MIRT1219382	hsa-miR-4712-3p	CLIP-seq
MIRT1219383	hsa-miR-4731-5p	CLIP-seq
MIRT1219384	hsa-miR-485-3p	CLIP-seq
MIRT1219385	hsa-miR-488	CLIP-seq
MIRT1219386	hsa-miR-497	CLIP-seq
MIRT1219387	hsa-miR-499-5p	CLIP-seq
MIRT1219388	hsa-miR-503	CLIP-seq
MIRT1219389	hsa-miR-5095	CLIP-seq
MIRT1219390	hsa-miR-512-3p	CLIP-seq
MIRT1219391	hsa-miR-516a-3p	CLIP-seq
MIRT1219392	hsa-miR-516b	CLIP-seq
MIRT1219393	hsa-miR-519d	CLIP-seq
MIRT1219394	hsa-miR-520a-3p	CLIP-seq
MIRT1219395	hsa-miR-520b	CLIP-seq
MIRT1219396	hsa-miR-520c-3p	CLIP-seq
MIRT1219397	hsa-miR-520d-3p	CLIP-seq
MIRT1219398	hsa-miR-520e	CLIP-seq
MIRT1219399	hsa-miR-520f	CLIP-seq
MIRT1219400	hsa-miR-520g	CLIP-seq
MIRT1219401	hsa-miR-520h	CLIP-seq
MIRT1219402	hsa-miR-522	CLIP-seq
MIRT1219403	hsa-miR-532-5p	CLIP-seq
MIRT1219404	hsa-miR-548ac	CLIP-seq
MIRT1219405	hsa-miR-548ae	CLIP-seq
MIRT1219406	hsa-miR-548aj	CLIP-seq
MIRT1219407	hsa-miR-548am	CLIP-seq
MIRT1219408	hsa-miR-548d-3p	CLIP-seq
MIRT1219409	hsa-miR-548x	CLIP-seq
MIRT1219410	hsa-miR-548z	CLIP-seq
MIRT1219411	hsa-miR-567	CLIP-seq
MIRT1219412	hsa-miR-579	CLIP-seq
MIRT1219413	hsa-miR-593	CLIP-seq
MIRT1219414	hsa-miR-633	CLIP-seq
MIRT1219415	hsa-miR-646	CLIP-seq
MIRT1219416	hsa-miR-670	CLIP-seq
MIRT1219417	hsa-miR-769-5p	CLIP-seq
MIRT1219418	hsa-miR-875-3p	CLIP-seq
MIRT1219419	hsa-miR-93	CLIP-seq
MIRT1219420	hsa-miR-96	CLIP-seq
MIRT1219421	hsa-miR-98	CLIP-seq
MIRT1219300	hsa-let-7a	CLIP-seq
MIRT1219301	hsa-let-7b	CLIP-seq
MIRT1219302	hsa-let-7c	CLIP-seq
MIRT1219303	hsa-let-7d	CLIP-seq
MIRT1219304	hsa-let-7e	CLIP-seq
MIRT1219305	hsa-let-7f	CLIP-seq
MIRT1219306	hsa-let-7g	CLIP-seq
MIRT1219307	hsa-let-7i	CLIP-seq
MIRT1219313	hsa-miR-1271	CLIP-seq
MIRT1219422	hsa-miR-129-3p	CLIP-seq
MIRT1219315	hsa-miR-144	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT1219319	hsa-miR-15a	CLIP-seq
MIRT1219320	hsa-miR-15b	CLIP-seq
MIRT1219321	hsa-miR-16	CLIP-seq
MIRT1219323	hsa-miR-182	CLIP-seq
MIRT1219324	hsa-miR-183	CLIP-seq
MIRT1219325	hsa-miR-186	CLIP-seq
MIRT1219423	hsa-miR-1915	CLIP-seq
MIRT1219328	hsa-miR-195	CLIP-seq
MIRT1219424	hsa-miR-200b	CLIP-seq
MIRT1219425	hsa-miR-200c	CLIP-seq
MIRT1219330	hsa-miR-202	CLIP-seq
MIRT1219335	hsa-miR-21	CLIP-seq
MIRT1219426	hsa-miR-217	CLIP-seq
MIRT1219427	hsa-miR-23a	CLIP-seq
MIRT1219428	hsa-miR-23b	CLIP-seq
MIRT1219429	hsa-miR-23c	CLIP-seq
MIRT1219342	hsa-miR-3133	CLIP-seq
MIRT1219430	hsa-miR-3149	CLIP-seq
MIRT1219431	hsa-miR-3161	CLIP-seq
MIRT1219343	hsa-miR-3170	CLIP-seq
MIRT1219432	hsa-miR-320b	CLIP-seq
MIRT1219433	hsa-miR-320c	CLIP-seq
MIRT1219434	hsa-miR-320d	CLIP-seq
MIRT1219345	hsa-miR-320e	CLIP-seq
MIRT1219351	hsa-miR-34a	CLIP-seq
MIRT1219352	hsa-miR-34c-5p	CLIP-seq
MIRT1219435	hsa-miR-3977	CLIP-seq
MIRT1219360	hsa-miR-410	CLIP-seq
MIRT1219361	hsa-miR-421	CLIP-seq
MIRT1219362	hsa-miR-424	CLIP-seq
MIRT1219436	hsa-miR-429	CLIP-seq
MIRT1219437	hsa-miR-4307	CLIP-seq
MIRT1219438	hsa-miR-4429	CLIP-seq
MIRT1219367	hsa-miR-4438	CLIP-seq
MIRT1219369	hsa-miR-4458	CLIP-seq
MIRT1219370	hsa-miR-449a	CLIP-seq
MIRT1219371	hsa-miR-449b	CLIP-seq
MIRT1219372	hsa-miR-4500	CLIP-seq
MIRT1219373	hsa-miR-4517	CLIP-seq
MIRT1219374	hsa-miR-4524	CLIP-seq
MIRT1219375	hsa-miR-4640-3p	CLIP-seq
MIRT1219376	hsa-miR-4641	CLIP-seq
MIRT1219381	hsa-miR-4709-5p	CLIP-seq
MIRT1219439	hsa-miR-4717-3p	CLIP-seq
MIRT1219440	hsa-miR-4726-3p	CLIP-seq
MIRT1219386	hsa-miR-497	CLIP-seq
MIRT1219441	hsa-miR-498	CLIP-seq
MIRT1219388	hsa-miR-503	CLIP-seq
MIRT1219389	hsa-miR-5095	CLIP-seq
MIRT1219442	hsa-miR-568	CLIP-seq
MIRT1219443	hsa-miR-577	CLIP-seq
MIRT1219444	hsa-miR-578	CLIP-seq
MIRT1219445	hsa-miR-580	CLIP-seq
MIRT1219415	hsa-miR-646	CLIP-seq
MIRT1219420	hsa-miR-96	CLIP-seq
MIRT1219421	hsa-miR-98	CLIP-seq
MIRT2063415	hsa-miR-1	CLIP-seq
MIRT2063416	hsa-miR-1283	CLIP-seq
MIRT2063417	hsa-miR-1323	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT2063418	hsa-miR-181a	CLIP-seq
MIRT2063419	hsa-miR-181b	CLIP-seq
MIRT2063420	hsa-miR-181c	CLIP-seq
MIRT2063421	hsa-miR-181d	CLIP-seq
MIRT2063422	hsa-miR-206	CLIP-seq
MIRT1219351	hsa-miR-34a	CLIP-seq
MIRT1219352	hsa-miR-34c-5p	CLIP-seq
MIRT1219353	hsa-miR-3653	CLIP-seq
MIRT2063423	hsa-miR-3673	CLIP-seq
MIRT2063424	hsa-miR-4262	CLIP-seq
MIRT1219370	hsa-miR-449a	CLIP-seq
MIRT1219371	hsa-miR-449b	CLIP-seq
MIRT2063425	hsa-miR-548o	CLIP-seq
MIRT2063426	hsa-miR-613	CLIP-seq
MIRT2063427	hsa-miR-890	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT1219300	hsa-let-7a	CLIP-seq
MIRT1219301	hsa-let-7b	CLIP-seq
MIRT1219302	hsa-let-7c	CLIP-seq
MIRT1219303	hsa-let-7d	CLIP-seq
MIRT1219304	hsa-let-7e	CLIP-seq
MIRT1219305	hsa-let-7f	CLIP-seq
MIRT1219306	hsa-let-7g	CLIP-seq
MIRT1219307	hsa-let-7i	CLIP-seq
MIRT2063415	hsa-miR-1	CLIP-seq
MIRT1219308	hsa-miR-106a	CLIP-seq
MIRT1219309	hsa-miR-106b	CLIP-seq
MIRT1219310	hsa-miR-1224-3p	CLIP-seq
MIRT1219311	hsa-miR-1234	CLIP-seq
MIRT2291857	hsa-miR-1245	CLIP-seq
MIRT1219312	hsa-miR-1264	CLIP-seq
MIRT1219313	hsa-miR-1271	CLIP-seq
MIRT2063416	hsa-miR-1283	CLIP-seq
MIRT1219422	hsa-miR-129-3p	CLIP-seq
MIRT2063417	hsa-miR-1323	CLIP-seq
MIRT2291858	hsa-miR-1324	CLIP-seq
MIRT2291859	hsa-miR-142-5p	CLIP-seq
MIRT1219315	hsa-miR-144	CLIP-seq
MIRT2291860	hsa-miR-147	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT2291861	hsa-miR-153	CLIP-seq
MIRT2291862	hsa-miR-155	CLIP-seq
MIRT2291863	hsa-miR-1587	CLIP-seq
MIRT1219319	hsa-miR-15a	CLIP-seq
MIRT1219320	hsa-miR-15b	CLIP-seq
MIRT1219321	hsa-miR-16	CLIP-seq
MIRT1219322	hsa-miR-17	CLIP-seq
MIRT2063418	hsa-miR-181a	CLIP-seq
MIRT2063419	hsa-miR-181b	CLIP-seq
MIRT2063420	hsa-miR-181c	CLIP-seq
MIRT2063421	hsa-miR-181d	CLIP-seq
MIRT1219323	hsa-miR-182	CLIP-seq
MIRT1219324	hsa-miR-183	CLIP-seq
MIRT1219325	hsa-miR-186	CLIP-seq
MIRT1219423	hsa-miR-1915	CLIP-seq
MIRT1219326	hsa-miR-193a-5p	CLIP-seq
MIRT1219328	hsa-miR-195	CLIP-seq
MIRT1219424	hsa-miR-200b	CLIP-seq
MIRT1219425	hsa-miR-200c	CLIP-seq
MIRT1219330	hsa-miR-202	CLIP-seq
MIRT2063422	hsa-miR-206	CLIP-seq
MIRT1219333	hsa-miR-20a	CLIP-seq
MIRT1219334	hsa-miR-20b	CLIP-seq
MIRT1219335	hsa-miR-21	CLIP-seq
MIRT1219427	hsa-miR-23a	CLIP-seq
MIRT1219428	hsa-miR-23b	CLIP-seq
MIRT1219429	hsa-miR-23c	CLIP-seq
MIRT1219337	hsa-miR-302a	CLIP-seq
MIRT1219338	hsa-miR-302b	CLIP-seq
MIRT1219339	hsa-miR-302c	CLIP-seq
MIRT1219340	hsa-miR-302d	CLIP-seq
MIRT1219341	hsa-miR-302e	CLIP-seq
MIRT2291864	hsa-miR-3119	CLIP-seq
MIRT1219342	hsa-miR-3133	CLIP-seq
MIRT2291865	hsa-miR-3134	CLIP-seq
MIRT2291866	hsa-miR-3147	CLIP-seq
MIRT1219430	hsa-miR-3149	CLIP-seq
MIRT1219431	hsa-miR-3161	CLIP-seq
MIRT1219343	hsa-miR-3170	CLIP-seq
MIRT2291867	hsa-miR-3177-5p	CLIP-seq
MIRT2291868	hsa-miR-3202	CLIP-seq
MIRT1219432	hsa-miR-320b	CLIP-seq
MIRT1219433	hsa-miR-320c	CLIP-seq
MIRT1219434	hsa-miR-320d	CLIP-seq
MIRT1219345	hsa-miR-320e	CLIP-seq
MIRT1219346	hsa-miR-323-3p	CLIP-seq
MIRT1219347	hsa-miR-326	CLIP-seq
MIRT1219348	hsa-miR-330-5p	CLIP-seq
MIRT1219349	hsa-miR-331-5p	CLIP-seq
MIRT1219351	hsa-miR-34a	CLIP-seq
MIRT1219352	hsa-miR-34c-5p	CLIP-seq
MIRT2291869	hsa-miR-3609	CLIP-seq
MIRT1219353	hsa-miR-3653	CLIP-seq
MIRT1219354	hsa-miR-3667-5p	CLIP-seq
MIRT2063423	hsa-miR-3673	CLIP-seq
MIRT2291870	hsa-miR-3680	CLIP-seq
MIRT1219356	hsa-miR-372	CLIP-seq
MIRT1219357	hsa-miR-373	CLIP-seq
MIRT2291871	hsa-miR-3913-3p	CLIP-seq
MIRT1219358	hsa-miR-3976	CLIP-seq
MIRT1219435	hsa-miR-3977	CLIP-seq
MIRT1219359	hsa-miR-3978	CLIP-seq
MIRT1219360	hsa-miR-410	CLIP-seq
MIRT1219361	hsa-miR-421	CLIP-seq
MIRT1219362	hsa-miR-424	CLIP-seq
MIRT2063424	hsa-miR-4262	CLIP-seq
MIRT1219436	hsa-miR-429	CLIP-seq
MIRT1219363	hsa-miR-4292	CLIP-seq
MIRT1219437	hsa-miR-4307	CLIP-seq
MIRT1219364	hsa-miR-4308	CLIP-seq
MIRT1219365	hsa-miR-4312	CLIP-seq
MIRT2291872	hsa-miR-4425	CLIP-seq
MIRT1219438	hsa-miR-4429	CLIP-seq
MIRT2291873	hsa-miR-4431	CLIP-seq
MIRT1219367	hsa-miR-4438	CLIP-seq
MIRT1219368	hsa-miR-4454	CLIP-seq
MIRT1219369	hsa-miR-4458	CLIP-seq
MIRT2291874	hsa-miR-4477b	CLIP-seq
MIRT2291875	hsa-miR-448	CLIP-seq
MIRT1219370	hsa-miR-449a	CLIP-seq
MIRT1219371	hsa-miR-449b	CLIP-seq
MIRT1219372	hsa-miR-4500	CLIP-seq
MIRT1219373	hsa-miR-4517	CLIP-seq
MIRT1219374	hsa-miR-4524	CLIP-seq
MIRT2291876	hsa-miR-4533	CLIP-seq
MIRT2291877	hsa-miR-4534	CLIP-seq
MIRT1219375	hsa-miR-4640-3p	CLIP-seq
MIRT1219376	hsa-miR-4641	CLIP-seq
MIRT1219378	hsa-miR-4659a-3p	CLIP-seq
MIRT2291878	hsa-miR-4659a-5p	CLIP-seq
MIRT1219379	hsa-miR-4659b-3p	CLIP-seq
MIRT2291879	hsa-miR-4659b-5p	CLIP-seq
MIRT2291880	hsa-miR-4674	CLIP-seq
MIRT2291881	hsa-miR-4678	CLIP-seq
MIRT2291882	hsa-miR-4699-5p	CLIP-seq
MIRT2291883	hsa-miR-4709-3p	CLIP-seq
MIRT1219381	hsa-miR-4709-5p	CLIP-seq
MIRT1219439	hsa-miR-4717-3p	CLIP-seq
MIRT1219440	hsa-miR-4726-3p	CLIP-seq
MIRT1219383	hsa-miR-4731-5p	CLIP-seq
MIRT2291884	hsa-miR-4772-3p	CLIP-seq
MIRT2291885	hsa-miR-4777-5p	CLIP-seq
MIRT2291886	hsa-miR-4796-3p	CLIP-seq
MIRT1219384	hsa-miR-485-3p	CLIP-seq
MIRT1219386	hsa-miR-497	CLIP-seq
MIRT1219441	hsa-miR-498	CLIP-seq
MIRT1219388	hsa-miR-503	CLIP-seq
MIRT1219389	hsa-miR-5095	CLIP-seq
MIRT1219390	hsa-miR-512-3p	CLIP-seq
MIRT1219392	hsa-miR-516b	CLIP-seq
MIRT2291887	hsa-miR-518d-5p	CLIP-seq
MIRT2291888	hsa-miR-519b-5p	CLIP-seq
MIRT2291889	hsa-miR-519c-5p	CLIP-seq
MIRT1219393	hsa-miR-519d	CLIP-seq
MIRT1219394	hsa-miR-520a-3p	CLIP-seq
MIRT1219395	hsa-miR-520b	CLIP-seq
MIRT1219396	hsa-miR-520c-3p	CLIP-seq
MIRT2291890	hsa-miR-520c-5p	CLIP-seq
MIRT1219397	hsa-miR-520d-3p	CLIP-seq
MIRT1219398	hsa-miR-520e	CLIP-seq
MIRT1219399	hsa-miR-520f	CLIP-seq
MIRT1219400	hsa-miR-520g	CLIP-seq
MIRT1219401	hsa-miR-520h	CLIP-seq
MIRT1219402	hsa-miR-522	CLIP-seq
MIRT2291891	hsa-miR-526a	CLIP-seq
MIRT1219403	hsa-miR-532-5p	CLIP-seq
MIRT2291892	hsa-miR-548ah	CLIP-seq
MIRT2063425	hsa-miR-548o	CLIP-seq
MIRT1219411	hsa-miR-567	CLIP-seq
MIRT1219442	hsa-miR-568	CLIP-seq
MIRT1219443	hsa-miR-577	CLIP-seq
MIRT2291893	hsa-miR-581	CLIP-seq
MIRT1219413	hsa-miR-593	CLIP-seq
MIRT2063426	hsa-miR-613	CLIP-seq
MIRT1219414	hsa-miR-633	CLIP-seq
MIRT1219415	hsa-miR-646	CLIP-seq
MIRT1219416	hsa-miR-670	CLIP-seq
MIRT2291894	hsa-miR-767-5p	CLIP-seq
MIRT1219418	hsa-miR-875-3p	CLIP-seq
MIRT2063427	hsa-miR-890	CLIP-seq
MIRT1219419	hsa-miR-93	CLIP-seq
MIRT1219420	hsa-miR-96	CLIP-seq
MIRT1219421	hsa-miR-98	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT1219423	hsa-miR-1915	CLIP-seq
MIRT1219440	hsa-miR-4726-3p	CLIP-seq
MIRT1219441	hsa-miR-498	CLIP-seq
MIRT1219308	hsa-miR-106a	CLIP-seq
MIRT1219309	hsa-miR-106b	CLIP-seq
MIRT1219310	hsa-miR-1224-3p	CLIP-seq
MIRT1219311	hsa-miR-1234	CLIP-seq
MIRT2291857	hsa-miR-1245	CLIP-seq
MIRT2589553	hsa-miR-1254	CLIP-seq
MIRT1219422	hsa-miR-129-3p	CLIP-seq
MIRT1219317	hsa-miR-1470	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT1219322	hsa-miR-17	CLIP-seq
MIRT1219423	hsa-miR-1915	CLIP-seq
MIRT2589554	hsa-miR-199a-5p	CLIP-seq
MIRT2589555	hsa-miR-199b-5p	CLIP-seq
MIRT1219333	hsa-miR-20a	CLIP-seq
MIRT1219334	hsa-miR-20b	CLIP-seq
MIRT1219335	hsa-miR-21	CLIP-seq
MIRT2589556	hsa-miR-2355-5p	CLIP-seq
MIRT1219337	hsa-miR-302a	CLIP-seq
MIRT1219338	hsa-miR-302b	CLIP-seq
MIRT1219339	hsa-miR-302c	CLIP-seq
MIRT1219340	hsa-miR-302d	CLIP-seq
MIRT1219341	hsa-miR-302e	CLIP-seq
MIRT2589557	hsa-miR-3116	CLIP-seq
MIRT1219430	hsa-miR-3149	CLIP-seq
MIRT2589558	hsa-miR-3613-3p	CLIP-seq
MIRT1219353	hsa-miR-3653	CLIP-seq
MIRT1219355	hsa-miR-3674	CLIP-seq
MIRT2589559	hsa-miR-3679-3p	CLIP-seq
MIRT1219356	hsa-miR-372	CLIP-seq
MIRT1219357	hsa-miR-373	CLIP-seq
MIRT2589560	hsa-miR-4282	CLIP-seq
MIRT2589561	hsa-miR-4313	CLIP-seq
MIRT1219367	hsa-miR-4438	CLIP-seq
MIRT2589562	hsa-miR-4446-5p	CLIP-seq
MIRT1219368	hsa-miR-4454	CLIP-seq
MIRT1219377	hsa-miR-4652-3p	CLIP-seq
MIRT1219380	hsa-miR-4667-3p	CLIP-seq
MIRT2589563	hsa-miR-4699-3p	CLIP-seq
MIRT1219440	hsa-miR-4726-3p	CLIP-seq
MIRT1219383	hsa-miR-4731-5p	CLIP-seq
MIRT2589564	hsa-miR-4775	CLIP-seq
MIRT2589565	hsa-miR-4794	CLIP-seq
MIRT1219441	hsa-miR-498	CLIP-seq
MIRT2589566	hsa-miR-502-5p	CLIP-seq
MIRT1219389	hsa-miR-5095	CLIP-seq
MIRT2589567	hsa-miR-5096	CLIP-seq
MIRT1219390	hsa-miR-512-3p	CLIP-seq
MIRT1219393	hsa-miR-519d	CLIP-seq
MIRT1219394	hsa-miR-520a-3p	CLIP-seq
MIRT1219395	hsa-miR-520b	CLIP-seq
MIRT1219396	hsa-miR-520c-3p	CLIP-seq
MIRT1219397	hsa-miR-520d-3p	CLIP-seq
MIRT1219398	hsa-miR-520e	CLIP-seq
MIRT1219400	hsa-miR-520g	CLIP-seq
MIRT1219401	hsa-miR-520h	CLIP-seq
MIRT2589568	hsa-miR-661	CLIP-seq
MIRT1219419	hsa-miR-93	CLIP-seq
MIRT1219308	hsa-miR-106a	CLIP-seq
MIRT1219309	hsa-miR-106b	CLIP-seq
MIRT1219310	hsa-miR-1224-3p	CLIP-seq
MIRT1219311	hsa-miR-1234	CLIP-seq
MIRT2291857	hsa-miR-1245	CLIP-seq
MIRT2589553	hsa-miR-1254	CLIP-seq
MIRT1219318	hsa-miR-150	CLIP-seq
MIRT1219322	hsa-miR-17	CLIP-seq
MIRT1219423	hsa-miR-1915	CLIP-seq
MIRT2589554	hsa-miR-199a-5p	CLIP-seq
MIRT2589555	hsa-miR-199b-5p	CLIP-seq
MIRT1219333	hsa-miR-20a	CLIP-seq
MIRT1219334	hsa-miR-20b	CLIP-seq
MIRT2589556	hsa-miR-2355-5p	CLIP-seq
MIRT1219337	hsa-miR-302a	CLIP-seq
MIRT1219338	hsa-miR-302b	CLIP-seq
MIRT1219339	hsa-miR-302c	CLIP-seq
MIRT1219340	hsa-miR-302d	CLIP-seq
MIRT1219341	hsa-miR-302e	CLIP-seq
MIRT2589557	hsa-miR-3116	CLIP-seq
MIRT1219430	hsa-miR-3149	CLIP-seq
MIRT2589559	hsa-miR-3679-3p	CLIP-seq
MIRT1219356	hsa-miR-372	CLIP-seq
MIRT1219357	hsa-miR-373	CLIP-seq
MIRT1219367	hsa-miR-4438	CLIP-seq
MIRT2589562	hsa-miR-4446-5p	CLIP-seq
MIRT1219368	hsa-miR-4454	CLIP-seq
MIRT1219440	hsa-miR-4726-3p	CLIP-seq
MIRT1219383	hsa-miR-4731-5p	CLIP-seq
MIRT2589565	hsa-miR-4794	CLIP-seq
MIRT1219441	hsa-miR-498	CLIP-seq
MIRT1219389	hsa-miR-5095	CLIP-seq
MIRT1219390	hsa-miR-512-3p	CLIP-seq
MIRT1219393	hsa-miR-519d	CLIP-seq
MIRT1219394	hsa-miR-520a-3p	CLIP-seq
MIRT1219395	hsa-miR-520b	CLIP-seq
MIRT1219396	hsa-miR-520c-3p	CLIP-seq
MIRT1219397	hsa-miR-520d-3p	CLIP-seq
MIRT1219398	hsa-miR-520e	CLIP-seq
MIRT1219400	hsa-miR-520g	CLIP-seq
MIRT1219401	hsa-miR-520h	CLIP-seq
MIRT2589568	hsa-miR-661	CLIP-seq
MIRT1219419	hsa-miR-93	CLIP-seq
MIRT1219367	hsa-miR-4438	CLIP-seq
MIRT1219389	hsa-miR-5095	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYB	Unknown	23606399

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	12054647, 16357133, 18296639, 19204291, 21163940, 24413684, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	16357133
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IMP	16357133
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	12054647
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	TAS	8543179
GO:0030509	Process	BMP signaling pathway	IDA	18548003
GO:0043508	Process	Negative regulation of JUN kinase activity	ISS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16357133
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050729	Process	Positive regulation of inflammatory response	ISS
GO:0060940	Process	Epithelial to mesenchymal transition involved in cardiac fibroblast development	ISS
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IMP	19946272
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IMP	28522568
GO:1904761	Process	Negative regulation of myofibroblast differentiation	IMP	20533548
GO:1905064	Process	Negative regulation of vascular associated smooth muscle cell differentiation	IDA	18548003
GO:1905461	Process	Positive regulation of vascular associated smooth muscle cell apoptotic process	IMP	28522568
GO:2000353	Process	Positive regulation of endothelial cell apoptotic process	IMP	24732886

MIM	HGNC	e!Ensembl
608610	8763	ENSG00000150593

Q53EL6

Protein name

Programmed cell death protein 4 (Neoplastic transformation inhibitor protein) (Nuclear antigen H731-like) (Protein 197/15a)

Protein function

Inhibits translation initiation and cap-dependent translation. May excert its function by hindering the interaction between EIF4A1 and EIF4G. Inhibits the helicase activity of EIF4A. Modulates the activation of JUN kinase. Down-regulates the exp

PDB

2GGF , 2KZT , 2RG8 , 2ZU6 , 3EIJ , 8XXL , 8XXM , 8XXN , 9BKD , 9BLN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02847	MA3	164 → 275	MA3 domain	Family
PF02847	MA3	327 → 440	MA3 domain	Family

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in proliferative cells. Highly expressed in epithelial cells of the mammary gland. Reduced expression in lung cancer and colon carcinoma. {ECO:0000269|PubMed:10632927, ECO:0000269|PubMed:12898601, ECO:0000269|PubMed:164496

Sequence

MDVENEQILNVNPADPDNLSDSLFSGDEENAGTEEIKNEINGNWISASSINEARINAKAK
RRLRKNSSRDSGRGDSVSDSGSDALRSGLTVPTSPKGRLLDRRSRSGKGRGLPKKGGAGG
KGVWGTPGQVYDVEEVDVKDPNYDDDQENCVYETVVLPLDERAFEKTLTPIIQEYFEHGD
TNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSF
DKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATV
LLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFH
HELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVP
HSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

Sequence length

469

Interactions

View interactions

	KEGG		Reactome
	Proteoglycans in cancer MicroRNAs in cancer		Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (224)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	27542230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17259349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12898601, 20514454, 21894439, 31756546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	17828298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19836969, 21279518, 30243936, 31756546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21775132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24786924		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21088996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29017439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23606399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23606399	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29017439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30205366	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25320244, 28437377, 28447761, 28901491, 29115490, 29328455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20702469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	25849652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	26252635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29512740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29110584	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	29340361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10632927, 15361828, 17982621, 18386173, 20498644, 22547075, 23102376, 26026468, 26212010, 27430936, 27476679, 30010689, 30365117, 30760284, 31169019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17991735, 19419954, 19633292, 21700716, 22524830, 23102376, 25611378, 26452030, 30365117, 30496290, 31556312, 32632815, 33744861, 35470783, 36552834, 38041032, 40332401 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18386173, 20498644, 26026468, 27028868	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	27852288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16449643, 36826085	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19901084, 20702469, 26189797, 26867589, 27876813, 33288677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15317660, 19728867, 23212265, 25175929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26367487, 29328455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19761702, 26404135	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20471435, 20602797, 20978511, 24633222, 26871813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10632927, 29512740, 31620370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29510060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12898601, 18457901, 23877371, 24334141, 25862855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	19031945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	21983937	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22203471, 23558936, 24902663, 28901491, 31789394, 33969128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26867589	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	19031945, 19493270, 19728867, 22272332, 23824073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	19473551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20560046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	23606399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21775132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	22213145, 23417858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	22289526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	27922982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28947822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21771721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16449643, 19836969, 23827854, 28692058, 29564000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16449643, 19784072, 32427870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	17828298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17968323, 19836969, 20815812, 21546206, 22267128, 24149370, 25310697, 27647131, 28692058, 29930217, 30003722, 30119236, 30243936, 30250581, 30914452, 31423204, 31760170 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17849461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17849461, 23533633	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21546206, 22363125, 24149370, 25310697, 30003722, 30914452, 33571679, 33726686	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23417858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24902663, 28927090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29131009, 30936987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29131009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	29131009, 35814945	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29131009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28389999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32358022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27240294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	23838800	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	17982621		★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	29805661		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	21061152	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	21330826, 29805661, 31233196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29912279, 31233196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	19031945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	20514454, 26345812, 27035745, 29331036, 30840273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	20514454, 26345812, 27035745, 30840273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	25211657, 25518924, 26345812, 30840273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25211657, 25518924	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	23219426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	22728051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	23212265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	29091952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19013014, 19602686, 21636706, 22907752, 23965755, 24413684, 25991676, 26142886, 28912531, 29340361, 30996288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19602686, 21649900, 22907752, 23965755, 24413684, 28912531, 29110584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19013014, 19602686, 21636706, 22907752, 22986533, 23965755, 24413684, 25991676, 26142886, 28912531, 29340361, 30066909, 30996288, 31269723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	17143488, 26846266, 29921407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18793349	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25080009, 37151605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27852288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	32632815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	27922982		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	27922982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30240970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20498644, 35814945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27913706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	26868993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	27240294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	27240294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	20702469, 21279518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	17982621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29923218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	25016284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	27533461, 28849168, 29510060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	22728051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	19906824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	19906824	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20148895, 25575817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	17259349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	17259349	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17259349, 25543261, 29100302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20831814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	26868993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19480673, 20602797, 20978511, 22322403, 22714713, 23604124, 24334270, 24633222, 26871813, 28592130, 28748353, 30687637, 31330233, 31384173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22153867, 30687637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	12898601, 18457901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	18457901		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	23877371, 26802652	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	27323401		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	29371906, 35850313	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21602271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21602271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	21602271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21602271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26150475	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	35306137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	17255358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	16449999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	16449999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27852288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	18793349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15361828, 17982621, 18386173, 20498644, 22547075, 23102376, 26026468, 26212010, 27430936, 27476679, 30010689, 30365117, 30760284, 31169019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	21330826, 29805661, 31233196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	20514454, 26345812, 27035745, 30840273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	29091952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	24902663, 28927090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23620665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12898601, 18457901, 23877371, 24334141, 25862855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	27323401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19493270, 19728867, 22272332, 23824073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21088996, 27279541, 29218103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19318582, 20092645, 23219426, 26252635, 30518628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	20372781, 21894439, 22212233, 23888942, 25144746, 25245333, 26961483, 27021515, 27634902, 28981115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	24609942, 30617160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29512740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12898601, 14985450, 17143488, 19836969, 20372781, 20498644, 20514454, 20661426, 21363911, 21775132, 22087031, 22267128, 22524830, 23102376, 23212265 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	22526161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19836969, 23827854, 29564000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17991735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22200873, 26026468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	22747440, 25316501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21775132		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24778037, 26150475, 30013768, 31769872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25002506, 30672666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26150475	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	26150475	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20702469	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	20831814, 21781452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25000828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31540771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36619896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	20143188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29100302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29218098, 30841417		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28683436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18570662, 24157866, 29017171, 30657562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	24157866, 27270423, 29017171, 30657562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10570194, 12898601, 14985450, 15062553, 15317660, 15361828, 15715967, 17143488, 17297470, 17828298, 17968323, 18270520, 18457901, 18549351, 18793349 View all (116 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	22526161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29017171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24331411, 25477028, 26802652, 28276898, 28423589, 28842954, 31445715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	17982621, 19473551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	22200873, 26868993, 27454120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26868993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular hypertension	Pubtator	37308277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	25611378, 26026468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	26867589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	26867589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26276504, 28742209, 34905503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28742209, 28781674, 29048648, 31637737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	19493270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	19728867	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28807003		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	19031945, 19493270, 19728867, 22272332, 23824073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19728867, 22272332, 23824073, 24888238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	24888238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21088996, 27279541, 29218103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21088996, 21983937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	26864640, 27279541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	24650454, 26063221, 31692513		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28495592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26868993, 30025387, 31423917, 31549864, 31851829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	26868993, 31549864, 31851829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31423917	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25979949, 26294715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	28807003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	22628023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	27765271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19318582, 20092645, 23219426, 26252635, 30518628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23219426, 26252635, 34525952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28467474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28927090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24902663, 28927090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30917906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	22087031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	30518812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18457901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20514454, 20831814, 22359108, 25175929, 27542230, 28910982, 31123403, 31807078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19276261, 25211657, 25400316, 25518924, 28854977, 29781054, 30519392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19260130, 20831814, 25760063, 28849168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	26867589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25175929, 25236707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	24609942, 25760063, 31602231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	20372781, 22212233, 23888942, 25144746, 25245333, 26961483, 27021515, 27634902, 28981115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24659669, 25144746, 26028073, 31859425, 34802261, 36366842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	22747440	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26637226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23212265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonsillitis	Tonsillitis	Pubtator	26867589	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26629823, 27028868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26629823, 27028868, 36552834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27824649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32271413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	20702469	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22194833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	22728051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	37399609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	37399609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PDCD4 (programmed cell death 4)