Gene Gene information from NCBI Gene database.
Entrez ID 27241
Gene name Bardet-Biedl syndrome 9
Gene symbol BBS9
Synonyms (NCBI Gene)
B1C18D1PTHB1
Chromosome 7
Chromosome location 7p14.3
Summary This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants
SNPs SNP information provided by dbSNP.
33
SNP ID Visualize variation Clinical significance Consequence
rs61753526 C>T Conflicting-interpretations-of-pathogenicity Non coding transcript variant, missense variant, genic downstream transcript variant, coding sequence variant
rs61764068 A>T Conflicting-interpretations-of-pathogenicity Genic downstream transcript variant, non coding transcript variant, missense variant, intron variant, coding sequence variant
rs137852856 C>T Pathogenic Non coding transcript variant, genic downstream transcript variant, coding sequence variant, stop gained
rs137852857 G>A Pathogenic Non coding transcript variant, missense variant, coding sequence variant
rs137852858 C>T Pathogenic Non coding transcript variant, coding sequence variant, stop gained
miRNA miRNA information provided by mirtarbase database.
57
miRTarBase ID miRNA Experiments Reference
MIRT017564 hsa-miR-335-5p Microarray 18185580
MIRT650436 hsa-miR-5582-3p HITS-CLIP 23824327
MIRT650435 hsa-miR-8084 HITS-CLIP 23824327
MIRT650434 hsa-miR-28-3p HITS-CLIP 23824327
MIRT650433 hsa-miR-5088-3p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
34
GO ID Ontology Definition Evidence Reference
GO:0000242 Component Pericentriolar material IDA 22139371
GO:0003674 Function Molecular_function ND
GO:0005515 Function Protein binding IPI 17574030, 19081074, 20080638, 22072986, 22139371, 22500027, 24550735, 25552655, 27173435, 28514442, 29039417, 33961781
GO:0005654 Component Nucleoplasm IDA
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
607968 30000 ENSG00000122507
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q3SYG4
Protein name Protein PTHB1 (Bardet-Biedl syndrome 9 protein) (Parathyroid hormone-responsive B1 gene protein)
Protein function The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio
PDB 4YD8 , 6XT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14727 PHTB1_N 1 418 PTHB1 N-terminus Family
PF14728 PHTB1_C 441 819 PTHB1 C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in adult heart, skeletal muscle, lung, liver, kidney, placenta and brain, and in fetal kidney, lung, liver and brain. {ECO:0000269|PubMed:10221542, ECO:0000269|PubMed:16380913}.
Sequence
MSLFKARDWWSTILGDKEEFDQGCLCLANVDNSGNGQDKIIVGSFMGYLRIFSPHPAKTG
DGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQ
CQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLL
PGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLN
IGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGT
INTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLHDLKGVIVTLSDDGHLQCSYLG
TDPSLFQAPNVQSRELNYDELDVEMKELQKIIKDVNKSQGVWPMTEREDDLNVSVVVS
PN
FDSVSQATDVEVGTDLVPSVTVKVTLQNRVILQKAKLSVYVQPPLELTCDQFTFEFMTPD
LTRTVSFSVYLKRSYTPSELEGNAVVSYSRPTDRNPDGIPRVIQCKFRLPLKLICLPGQP
SKTASHKITIDTNKSPVSLLSLFPGFASQSDDDQVNVMGFHFLGGARITVLASKTSQRYR
IQSEQFEDLWLITNELILRLQEYFEKQGVKDFACSFSGSIPLQEYFELIDHHFELRINGE
KLEELLSERAVQFRAIQRRLLARFKDKTPAPLQHLDTLLDGTYKQVIALADAVEENQGNL
FQSFTRLKSATHLVILLIALWQKLSADQVAILEAAFLPLQEDTQELGWEETVDAAISHLL
KTCLSKSSKEQALNLNSQLNIPKDTSQLKKHITLLCDRL
SKGGRLCLSTDAAAPQTMVMP
GGCTTIPESDLEERSVEQDSTELFTNHRHLTAETPRPEVSPLQGVSE
Sequence length 887
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
43
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Abnormality of the eye Likely pathogenic; Pathogenic rs2128345173, rs948418225 RCV001814317
RCV001814316
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Bardet-Biedl syndrome Likely pathogenic; Pathogenic rs2128345173, rs2128667543, rs948418225, rs1266192229, rs2128756914, rs1401715737, rs1815414782, rs137962929, rs2128344662, rs748601675, rs1864348159, rs2128108391, rs2128344706, rs2128646927, rs998200637
View all (57 more)
RCV001388670
RCV001386353
RCV001388265
RCV001388047
RCV001387040
View all (71 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bardet-Biedl syndrome 1 Pathogenic rs606231137 RCV000709632
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Bardet-Biedl syndrome 9 Likely pathogenic; Pathogenic rs2128667543, rs948418225, rs1266192229, rs1454474832, rs1401715737, rs779588488, rs1815414782, rs748601675, rs2128325966, rs2128646927, rs998200637, rs201938124, rs137852856, rs587777810, rs137852857
View all (57 more)
RCV002499805
RCV002488210
RCV002493931
RCV002501865
RCV001839344
View all (68 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BBS9-related ciliopathy Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
CILIOPATHIES Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acrocephaly Acrocephaly CTD_human_DG 23160099
★☆☆☆☆
Found in Text Mining only
Age related macular degeneration Age-related macular degeneration GWASCAT_DG 29346644
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 31557306 Associate
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial fibrillation Pubtator 30678657 Associate
★☆☆☆☆
Found in Text Mining only
Bardet-Biedl Syndrome Bardet-Biedl Syndrome LHGDN 16380913
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bardet-Biedl Syndrome Bardet-Biedl Syndrome CLINVAR_DG 16380913, 30614526
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bardet-Biedl syndrome Bardet-Biedl Syndrome Orphanet
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bardet-Biedl Syndrome Bardet-Biedl Syndrome BEFREE 22479622, 26085087, 26846096, 27486776, 28624958, 29674126, 31530639
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bardet-Biedl syndrome 1 (disorder) Bardet-Biedl Syndrome GENOMICS_ENGLAND_DG
★☆☆☆☆
Found in Text Mining only
Bardet-Biedl syndrome 1 (disorder) Bardet-Biedl Syndrome CLINVAR_DG
★☆☆☆☆
Found in Text Mining only