Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27237
Gene name	Rho guanine nucleotide exchange factor 16
Gene symbol	ARHGEF16
Synonyms (NCBI Gene)	GEF16NBR
Chromosome	1
Chromosome location	1p36.32
Summary	Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq, Jul 2008]

Show/Hide all (4)

miRTarBase ID	miRNA	Experiments
MIRT1934909	hsa-miR-1470	CLIP-seq
MIRT1934910	hsa-miR-4469	CLIP-seq
MIRT1934911	hsa-miR-4667-3p	CLIP-seq
MIRT1934912	hsa-miR-769-5p	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IDA	20679435
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005096	Function	GTPase activator activity	IDA	21139582
GO:0005515	Function	Protein binding	IPI	15161933, 15778465, 20679435, 25416956, 28514442, 30126976, 32203420, 32296183, 33961781, 36931259
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0030165	Function	PDZ domain binding	IPI	21139582
GO:0030971	Function	Receptor tyrosine kinase binding	IPI	20679435
GO:0031267	Function	Small GTPase binding	IPI	20679435, 21139582
GO:0032489	Process	Regulation of Cdc42 protein signal transduction	IDA	21139582
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0060326	Process	Cell chemotaxis	IMP	20679435
GO:0090630	Process	Activation of GTPase activity	IMP	20679435
GO:1903078	Process	Positive regulation of protein localization to plasma membrane	IMP	20679435

MIM	HGNC	e!Ensembl
618871	15515	ENSG00000130762

Q5VV41

Protein name

Rho guanine nucleotide exchange factor 16 (Ephexin-4)

Protein function

Guanyl-nucleotide exchange factor of the RHOG GTPase stimulating the exchange of RHOG-associated GDP for GTP. May play a role in chemotactic cell migration by mediating the activation of RAC1 by EPHA2. May also activate CDC42 and mediate activat

PDB

1X6B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00621	RhoGEF	288 → 466	RhoGEF domain	Domain
PF00169	PH	502 → 620	PH domain	Domain
PF14604	SH3_9	637 → 685	Variant SH3 domain	Domain

Sequence

MAQRHSDSSLEEKLLGHRFHSELRLDAGGNPASGLPMVRGSPRVRDDAAFQPQVPAPPQP
RPPGHEEPWPIVLSTESPAALKLGTQQLIPKSLAVASKAKTPARHQSFGAAVLSREAARR
DPKLLPAPSFSLDDMDVDKDPGGMLRRNLRNQSYRAAMKGLGKPGGQGDAIQLSPKLQAL
AEEPSQPHTRSPAKNKKTLGRKRGHKGSFKDDPQLYQEIQERGLNTSQESDDDILDESSS
PEGTQKVDATIVVKSYRPAQVTWSQLPEVVELGILDQLSTEERKRQEAMFEILTSEFSYQ
HSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDIS
DILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFL
ILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYT
LHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKK
KSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLL
SSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQ
QEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV

Sequence length

709

Interactions

View interactions

	Reactome
			NRAGE signals death through JNK Rho GTPase cycle G alpha (12/13) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32811808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	38303513	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	21760942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	21760942		★★★★★ ★☆☆☆☆ Found in Text Mining only

ARHGEF16 (Rho guanine nucleotide exchange factor 16)