Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27201
Gene name	G protein-coupled receptor 78
Gene symbol	GPR78
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4p16.1
Summary	The protein encoded by this gene belongs to the G protein-coupled receptor family, which contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. This is an orphan receptor, which displays significant level of

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT007057	hsa-miR-30d-5p	Luciferase reporter assay	23085757
MIRT007058	hsa-miR-181a-5p	Luciferase reporter assay	23085757
MIRT007061	hsa-miR-199a-5p	Luciferase reporter assay	23085757
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT640635	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT629466	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT640635	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT629466	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT629466	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT640635	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT629466	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT640635	hsa-miR-6758-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT629466	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT629466	hsa-miR-181d-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT618547	hsa-miR-8485	HITS-CLIP	23824327
MIRT618546	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT618545	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT618544	hsa-miR-6800-3p	HITS-CLIP	23824327
MIRT618543	hsa-miR-1228-3p	HITS-CLIP	23824327
MIRT618542	hsa-miR-377-3p	HITS-CLIP	23824327
MIRT1031789	hsa-miR-4274	CLIP-seq
MIRT1031790	hsa-miR-4279	CLIP-seq
MIRT1031791	hsa-miR-4704-3p	CLIP-seq
MIRT1031792	hsa-miR-486-5p	CLIP-seq
MIRT2006029	hsa-miR-3158-3p	CLIP-seq
MIRT2006030	hsa-miR-4530	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IDA	17363172
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	26940976
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	17363172
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
606921	4528	ENSG00000155269

Q96P69

Protein name

G-protein coupled receptor 78

Protein function

Orphan receptor. Displays a significant level of constitutive activity. Its effect is mediated by G(s)-alpha protein that stimulate adenylate cyclase, resulting in an elevation of intracellular cAMP.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	22 → 294	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: High level of expression in placenta. Expressed throughout the brain at low level. No expression detected in skeletal muscle, lung, heart, liver, pancreas, or kidney. {ECO:0000269|PubMed:17363172}.

Sequence

MGPGEALLAGLLVMVLAVALLSNALVLLCCAYSAELRTRASGVLLVNLSLGHLLLAALDM
PFTLLGVMRGRTPSAPGACQVIGFLDTFLASNAALSVAALSADQWLAVGFPLRYAGRLRP
RYAGLLLGCAWGQSLAFSGAALGCSWLGYSSAFASCSLRLPPEPERPRFAAFTATLHAVG
FVLPLAVLCLTSLQVHRVARRHCQRMDTVTMKALALLADLHPSVRQRCLIQQKRRRHRAT
RKIGIAIATFLICFAPYVMTRLAELVPFVTVNAQWGILSKCLTYSKAVADPFTYSLLRRP
FRQVLAGMVHRLLKRTPRPASTHDSSLDVAGMVHQLLKRTPRPASTHNGSVDTENDSCLQ
QTH

Sequence length

363

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE GASTRIC ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROBLASTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bipolar Disorder	Bipolar Disorder	BEFREE	16389273		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	16389273		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	35301432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27697106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35301432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	31333410		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16389273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27697106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	GWASCAT_DG	28545128		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	31333410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16389273		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	16389273		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31710242		★★★★★ ★☆☆☆☆ Found in Text Mining only

GPR78 (G protein-coupled receptor 78)