Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	27185
Gene name	DISC1 scaffold protein
Gene symbol	DISC1
Synonyms (NCBI Gene)	C1orf136SCZD9
Chromosome	1
Chromosome location	1q42.2
Summary	This gene encodes a protein with multiple coiled coil motifs which is located in the nucleus, cytoplasm and mitochondria. The protein is involved in neurite outgrowth and cortical development through its interaction with other proteins. This gene is disru

317

Show/Hide all (317)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023117	hsa-miR-124-3p	Microarray	18668037
MIRT643487	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT643486	hsa-miR-622	HITS-CLIP	23824327
MIRT643485	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT643484	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT643483	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT643482	hsa-miR-4291	HITS-CLIP	23824327
MIRT452954	hsa-miR-490-3p	PAR-CLIP	23592263
MIRT452953	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT452952	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT452951	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT452950	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT452949	hsa-miR-5186	PAR-CLIP	23592263
MIRT452948	hsa-miR-4537	PAR-CLIP	23592263
MIRT452947	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT452946	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT452945	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT452944	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT452943	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT452942	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT452941	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT452940	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT452939	hsa-miR-4458	PAR-CLIP	23592263
MIRT452938	hsa-miR-4500	PAR-CLIP	23592263
MIRT452937	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT452936	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT452935	hsa-miR-6086	PAR-CLIP	23592263
MIRT452934	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT452933	hsa-miR-4706	PAR-CLIP	23592263
MIRT452932	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT452931	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT452930	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT452929	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT452928	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT452927	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT452926	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT452925	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT452924	hsa-miR-4451	PAR-CLIP	23592263
MIRT452923	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT452922	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT452921	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT452920	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT452919	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT452918	hsa-miR-3689c	PAR-CLIP	23592263
MIRT452917	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT452916	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT452915	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT452947	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT452947	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT452946	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT452946	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT452945	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT452945	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT452944	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT452944	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT452943	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT452943	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT452942	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT452942	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT452941	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT452941	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT452940	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT452940	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT452922	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT452922	hsa-miR-1273h-5p	PAR-CLIP	26701625
MIRT452929	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT452929	hsa-miR-149-3p	PAR-CLIP	26701625
MIRT452921	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT452921	hsa-miR-30b-3p	PAR-CLIP	26701625
MIRT452950	hsa-miR-3192-5p	PAR-CLIP	26701625
MIRT452950	hsa-miR-3192-5p	PAR-CLIP	26701625
MIRT452920	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT452920	hsa-miR-3689a-3p	PAR-CLIP	26701625
MIRT452919	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT452919	hsa-miR-3689b-3p	PAR-CLIP	26701625
MIRT452918	hsa-miR-3689c	PAR-CLIP	26701625
MIRT452918	hsa-miR-3689c	PAR-CLIP	26701625
MIRT452936	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT452936	hsa-miR-377-5p	PAR-CLIP	26701625
MIRT452952	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT452952	hsa-miR-3927-3p	PAR-CLIP	26701625
MIRT452924	hsa-miR-4451	PAR-CLIP	26701625
MIRT452924	hsa-miR-4451	PAR-CLIP	26701625
MIRT452939	hsa-miR-4458	PAR-CLIP	26701625
MIRT452939	hsa-miR-4458	PAR-CLIP	26701625
MIRT452938	hsa-miR-4500	PAR-CLIP	26701625
MIRT452938	hsa-miR-4500	PAR-CLIP	26701625
MIRT452948	hsa-miR-4537	PAR-CLIP	26701625
MIRT452948	hsa-miR-4537	PAR-CLIP	26701625
MIRT452923	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT452923	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT452928	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT452928	hsa-miR-4728-5p	PAR-CLIP	26701625
MIRT452954	hsa-miR-490-3p	PAR-CLIP	26701625
MIRT452954	hsa-miR-490-3p	PAR-CLIP	26701625
MIRT452949	hsa-miR-5186	PAR-CLIP	26701625
MIRT452949	hsa-miR-5186	PAR-CLIP	26701625
MIRT452935	hsa-miR-6086	PAR-CLIP	26701625
MIRT452935	hsa-miR-6086	PAR-CLIP	26701625
MIRT452934	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT452934	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT452915	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT452915	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT452917	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT452917	hsa-miR-6779-5p	PAR-CLIP	26701625
MIRT452916	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT452916	hsa-miR-6780a-5p	PAR-CLIP	26701625
MIRT452927	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT452927	hsa-miR-6785-5p	PAR-CLIP	26701625
MIRT452925	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT452925	hsa-miR-6799-5p	PAR-CLIP	26701625
MIRT452951	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT452951	hsa-miR-6831-5p	PAR-CLIP	26701625
MIRT452926	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT452926	hsa-miR-6883-5p	PAR-CLIP	26701625
MIRT452930	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT452930	hsa-miR-7106-5p	PAR-CLIP	26701625
MIRT452953	hsa-miR-7851-3p	PAR-CLIP	26701625
MIRT452953	hsa-miR-7851-3p	PAR-CLIP	26701625
MIRT452937	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT452937	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT452947	hsa-let-7a-5p	PAR-CLIP	27292025
MIRT452946	hsa-let-7b-5p	PAR-CLIP	27292025
MIRT452945	hsa-let-7c-5p	PAR-CLIP	27292025
MIRT452944	hsa-let-7d-5p	PAR-CLIP	27292025
MIRT452943	hsa-let-7e-5p	PAR-CLIP	27292025
MIRT452942	hsa-let-7f-5p	PAR-CLIP	27292025
MIRT452941	hsa-let-7g-5p	PAR-CLIP	27292025
MIRT452940	hsa-let-7i-5p	PAR-CLIP	27292025
MIRT452922	hsa-miR-1273h-5p	PAR-CLIP	27292025
MIRT452929	hsa-miR-149-3p	PAR-CLIP	27292025
MIRT452921	hsa-miR-30b-3p	PAR-CLIP	27292025
MIRT452950	hsa-miR-3192-5p	PAR-CLIP	27292025
MIRT452920	hsa-miR-3689a-3p	PAR-CLIP	27292025
MIRT452919	hsa-miR-3689b-3p	PAR-CLIP	27292025
MIRT452918	hsa-miR-3689c	PAR-CLIP	27292025
MIRT452936	hsa-miR-377-5p	PAR-CLIP	27292025
MIRT452952	hsa-miR-3927-3p	PAR-CLIP	27292025
MIRT452924	hsa-miR-4451	PAR-CLIP	27292025
MIRT452939	hsa-miR-4458	PAR-CLIP	27292025
MIRT452938	hsa-miR-4500	PAR-CLIP	27292025
MIRT452948	hsa-miR-4537	PAR-CLIP	27292025
MIRT452923	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT452928	hsa-miR-4728-5p	PAR-CLIP	27292025
MIRT452954	hsa-miR-490-3p	PAR-CLIP	27292025
MIRT452949	hsa-miR-5186	PAR-CLIP	27292025
MIRT452935	hsa-miR-6086	PAR-CLIP	27292025
MIRT452934	hsa-miR-6499-3p	PAR-CLIP	27292025
MIRT452915	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT452917	hsa-miR-6779-5p	PAR-CLIP	27292025
MIRT452916	hsa-miR-6780a-5p	PAR-CLIP	27292025
MIRT452927	hsa-miR-6785-5p	PAR-CLIP	27292025
MIRT452925	hsa-miR-6799-5p	PAR-CLIP	27292025
MIRT452951	hsa-miR-6831-5p	PAR-CLIP	27292025
MIRT452926	hsa-miR-6883-5p	PAR-CLIP	27292025
MIRT452930	hsa-miR-7106-5p	PAR-CLIP	27292025
MIRT452953	hsa-miR-7851-3p	PAR-CLIP	27292025
MIRT452937	hsa-miR-98-5p	PAR-CLIP	27292025
MIRT643487	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT643486	hsa-miR-622	HITS-CLIP	23824327
MIRT643485	hsa-miR-136-5p	HITS-CLIP	23824327
MIRT643484	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT643483	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT643482	hsa-miR-4291	HITS-CLIP	23824327
MIRT452954	hsa-miR-490-3p	PAR-CLIP	23592263
MIRT452953	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT452952	hsa-miR-3927-3p	PAR-CLIP	23592263
MIRT452951	hsa-miR-6831-5p	PAR-CLIP	23592263
MIRT452950	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT452949	hsa-miR-5186	PAR-CLIP	23592263
MIRT452948	hsa-miR-4537	PAR-CLIP	23592263
MIRT452947	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT452946	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT452945	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT452944	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT452943	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT452942	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT452941	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT452940	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT452939	hsa-miR-4458	PAR-CLIP	23592263
MIRT452938	hsa-miR-4500	PAR-CLIP	23592263
MIRT452937	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT452936	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT452935	hsa-miR-6086	PAR-CLIP	23592263
MIRT452934	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT452933	hsa-miR-4706	PAR-CLIP	23592263
MIRT452932	hsa-miR-4749-5p	PAR-CLIP	23592263
MIRT452931	hsa-miR-744-5p	PAR-CLIP	23592263
MIRT452930	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT452929	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT452928	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT452927	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT452926	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT452925	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT452924	hsa-miR-4451	PAR-CLIP	23592263
MIRT452923	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT452922	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT452921	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT452920	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT452919	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT452918	hsa-miR-3689c	PAR-CLIP	23592263
MIRT452917	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT452916	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT452915	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT937222	hsa-miR-1285	CLIP-seq
MIRT937223	hsa-miR-192	CLIP-seq
MIRT937224	hsa-miR-198	CLIP-seq
MIRT937225	hsa-miR-215	CLIP-seq
MIRT937226	hsa-miR-3187-5p	CLIP-seq
MIRT937227	hsa-miR-4645-3p	CLIP-seq
MIRT937228	hsa-miR-612	CLIP-seq
MIRT937229	hsa-miR-101	CLIP-seq
MIRT937230	hsa-miR-106a	CLIP-seq
MIRT937231	hsa-miR-106b	CLIP-seq
MIRT937232	hsa-miR-17	CLIP-seq
MIRT937233	hsa-miR-20a	CLIP-seq
MIRT937234	hsa-miR-20b	CLIP-seq
MIRT937235	hsa-miR-3609	CLIP-seq
MIRT937236	hsa-miR-4796-3p	CLIP-seq
MIRT937237	hsa-miR-519d	CLIP-seq
MIRT937238	hsa-miR-548ah	CLIP-seq
MIRT937239	hsa-miR-93	CLIP-seq
MIRT937240	hsa-miR-1254	CLIP-seq
MIRT937241	hsa-miR-1256	CLIP-seq
MIRT937242	hsa-miR-1278	CLIP-seq
MIRT937243	hsa-miR-1343	CLIP-seq
MIRT937244	hsa-miR-140-5p	CLIP-seq
MIRT937245	hsa-miR-146b-3p	CLIP-seq
MIRT937246	hsa-miR-1827	CLIP-seq
MIRT937247	hsa-miR-1908	CLIP-seq
MIRT937248	hsa-miR-1911	CLIP-seq
MIRT937249	hsa-miR-1914	CLIP-seq
MIRT937250	hsa-miR-2110	CLIP-seq
MIRT937251	hsa-miR-217	CLIP-seq
MIRT937252	hsa-miR-3074-5p	CLIP-seq
MIRT937253	hsa-miR-3116	CLIP-seq
MIRT937254	hsa-miR-3152-3p	CLIP-seq
MIRT937255	hsa-miR-3155	CLIP-seq
MIRT937256	hsa-miR-3155b	CLIP-seq
MIRT937257	hsa-miR-3190	CLIP-seq
MIRT937258	hsa-miR-331-3p	CLIP-seq
MIRT937259	hsa-miR-339-5p	CLIP-seq
MIRT937260	hsa-miR-3617	CLIP-seq
MIRT937261	hsa-miR-371-5p	CLIP-seq
MIRT937262	hsa-miR-371b-5p	CLIP-seq
MIRT937263	hsa-miR-3929	CLIP-seq
MIRT937264	hsa-miR-4271	CLIP-seq
MIRT937265	hsa-miR-4418	CLIP-seq
MIRT937266	hsa-miR-4419b	CLIP-seq
MIRT937267	hsa-miR-4421	CLIP-seq
MIRT937268	hsa-miR-4478	CLIP-seq
MIRT937269	hsa-miR-4481	CLIP-seq
MIRT937270	hsa-miR-4649-3p	CLIP-seq
MIRT937271	hsa-miR-4658	CLIP-seq
MIRT937272	hsa-miR-4667-5p	CLIP-seq
MIRT937273	hsa-miR-4677-3p	CLIP-seq
MIRT937274	hsa-miR-4684-5p	CLIP-seq
MIRT937275	hsa-miR-4700-5p	CLIP-seq
MIRT937276	hsa-miR-4720-5p	CLIP-seq
MIRT937277	hsa-miR-4723-5p	CLIP-seq
MIRT937278	hsa-miR-4725-3p	CLIP-seq
MIRT937279	hsa-miR-4745-5p	CLIP-seq
MIRT937280	hsa-miR-4758-5p	CLIP-seq
MIRT937281	hsa-miR-4762-5p	CLIP-seq
MIRT937282	hsa-miR-4765	CLIP-seq
MIRT937283	hsa-miR-4766-5p	CLIP-seq
MIRT937284	hsa-miR-4786-3p	CLIP-seq
MIRT937285	hsa-miR-4789-5p	CLIP-seq
MIRT937286	hsa-miR-4793-3p	CLIP-seq
MIRT937287	hsa-miR-4799-3p	CLIP-seq
MIRT937288	hsa-miR-484	CLIP-seq
MIRT937289	hsa-miR-485-5p	CLIP-seq
MIRT937290	hsa-miR-494	CLIP-seq
MIRT937291	hsa-miR-509-3-5p	CLIP-seq
MIRT937292	hsa-miR-509-5p	CLIP-seq
MIRT937293	hsa-miR-548c-3p	CLIP-seq
MIRT937294	hsa-miR-552	CLIP-seq
MIRT937295	hsa-miR-593	CLIP-seq
MIRT937296	hsa-miR-641	CLIP-seq
MIRT937297	hsa-miR-652	CLIP-seq
MIRT937298	hsa-miR-661	CLIP-seq
MIRT937299	hsa-miR-663	CLIP-seq
MIRT937300	hsa-miR-7	CLIP-seq
MIRT937301	hsa-miR-890	CLIP-seq
MIRT937302	hsa-miR-892a	CLIP-seq
MIRT937240	hsa-miR-1254	CLIP-seq
MIRT937253	hsa-miR-3116	CLIP-seq
MIRT937303	hsa-miR-4701-5p	CLIP-seq
MIRT937304	hsa-miR-4727-5p	CLIP-seq
MIRT937305	hsa-miR-543	CLIP-seq
MIRT937306	hsa-miR-588	CLIP-seq
MIRT937298	hsa-miR-661	CLIP-seq
MIRT937307	hsa-miR-1224-3p	CLIP-seq
MIRT937308	hsa-miR-1299	CLIP-seq
MIRT937309	hsa-miR-4286	CLIP-seq
MIRT937300	hsa-miR-7	CLIP-seq
MIRT937310	hsa-miR-875-3p	CLIP-seq
MIRT2212768	hsa-miR-2964a-5p	CLIP-seq
MIRT2212769	hsa-miR-433	CLIP-seq
MIRT2212770	hsa-miR-4509	CLIP-seq
MIRT2212771	hsa-miR-4725-5p	CLIP-seq
MIRT2212772	hsa-miR-4744	CLIP-seq
MIRT2212773	hsa-miR-4780	CLIP-seq
MIRT2212774	hsa-miR-504	CLIP-seq
MIRT2212775	hsa-miR-563	CLIP-seq
MIRT2212776	hsa-miR-584	CLIP-seq
MIRT2212777	hsa-miR-602	CLIP-seq
MIRT2448275	hsa-miR-1252	CLIP-seq
MIRT2448276	hsa-miR-214	CLIP-seq
MIRT2448277	hsa-miR-3154	CLIP-seq
MIRT2448278	hsa-miR-3619-5p	CLIP-seq
MIRT2448279	hsa-miR-4293	CLIP-seq
MIRT2448280	hsa-miR-4530	CLIP-seq
MIRT2448281	hsa-miR-4690-3p	CLIP-seq
MIRT2448282	hsa-miR-4722-5p	CLIP-seq
MIRT2448283	hsa-miR-545	CLIP-seq
MIRT2448284	hsa-miR-761	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
ATF4	Unknown	12812986
ATF5	Unknown	12812986

Show/Hide all (69)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	18955030
GO:0001764	Process	Neuron migration	IBA
GO:0001764	Process	Neuron migration	IEA
GO:0001764	Process	Neuron migration	IMP	19502360
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IEA
GO:0002052	Process	Positive regulation of neuroblast proliferation	IGI	19303846
GO:0005515	Function	Protein binding	IPI	12812986, 15094396, 17035248, 17043677, 17389905, 18762586, 18955030, 20880836, 20956536, 22153077, 22228767, 28514442, 29961565, 31413325, 32296183, 32493513, 32707033, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	20880836
GO:0005739	Component	Mitochondrion	IEA
GO:0005813	Component	Centrosome	IDA	18762586, 18955030, 20531939
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IEA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008104	Process	Intracellular protein localization	IEA
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0014069	Component	Postsynaptic density	IDA	16736468
GO:0014069	Component	Postsynaptic density	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0019894	Function	Kinesin binding	IEA
GO:0021799	Process	Cerebral cortex radially oriented cell migration	IEA
GO:0021846	Process	Cell proliferation in forebrain	IEA
GO:0021852	Process	Pyramidal neuron migration to cerebral cortex	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IGI	19303846
GO:0030286	Component	Dynein complex	IEA
GO:0030424	Component	Axon	IEA
GO:0031929	Process	TOR signaling	IEA
GO:0036064	Component	Ciliary basal body	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	30561706
GO:0044297	Component	Cell body	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IBA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0045202	Component	Synapse	IEA
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050965	Process	Detection of temperature stimulus involved in sensory perception of pain	IEA
GO:0051560	Process	Mitochondrial calcium ion homeostasis	IEA
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051966	Process	Regulation of synaptic transmission, glutamatergic	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060271	Process	Cilium assembly	IBA
GO:0060271	Process	Cilium assembly	IEA
GO:0060998	Process	Regulation of dendritic spine development	IEA
GO:0070050	Process	Neuron cellular homeostasis	IEA
GO:0071539	Process	Protein localization to centrosome	IEA
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0090724	Component	Central region of growth cone	IEA
GO:0097546	Component	Ciliary base	IDA	20531939
GO:0098793	Component	Presynapse	IDA	16736468
GO:0098978	Component	Glutamatergic synapse	IDA	16736468
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IDA	16736468
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:1905515	Process	Non-motile cilium assembly	IEA
GO:1905515	Process	Non-motile cilium assembly	IMP	20531939
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA

MIM	HGNC	e!Ensembl
605210	2888	ENSG00000162946

Q9NRI5

Protein name

Disrupted in schizophrenia 1 protein

Protein function

Involved in the regulation of multiple aspects of embryonic and adult neurogenesis (PubMed:19303846, PubMed:19502360). Required for neural progenitor proliferation in the ventrical/subventrical zone during embryonic brain development and in the

PDB

5V4B

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Highly expressed in the dentate gyrus of the hippocampus. Also expressed in the temporal and parahippocampal cortices and cells of the white matter. {ECO:0000269|PubMed:16510495}.

Sequence

MPGGGPQGAPAAAGGGGVSHRAGSRDCLPPAACFRRRRLARRPGYMRSSTGPGIGFLSPA
VGTLFRFPGGVSGEESHHSESRARQCGLDSRGLLVRSPVSKSAAAPTVTSVRGTSAHFGI
QLRGGTRLPDRLSWPCGPGSAGWQQEFAAMDSSETLDASWEAACSDGARRVRAAGSLPSA
ELSSNSCSPGCGPEVPPTPPGSHSAFTSSFSFIRLSLGSAGERGEAEGCPPSREAESHCQ
SPQEMGAKAASLDGPHEDPRCLSRPFSLLATRVSADLAQAARNSSRPERDMHSLPDMDPG
SSSSLDPSLAGCGGDGSSGSGDAHSWDTLLRKWEPVLRDCLLRNRRQMEVISLRLKLQKL
QEDAVENDDYDKAETLQQRLEDLEQEKISLHFQLPSRQPALSSFLGHLAAQVQAALRRGA
TQQASGDDTHTPLRMEPRLLEPTAQDSLHVSITRRDWLLQEKQQLQKEIEALQARMFVLE
AKDQQLRREIEEQEQQLQWQGCDLTPLVGQLSLGQLQEVSKALQDTLASAGQIPFHAEPP
ETIRSLQERIKSLNLSLKEITTKVCMSEKFCSTLRKKVNDIETQLPALLEAKMHAISGNH
FWTAKDLTEEIRSLTSEREGLEGLLSKLLVLSSRNVKKLGSVKEDYNRLRREVEHQETAY
ETSVKENTMKYMETLKNKLCSCKCPLLGKVWEADLEACRLLIQSLQLQEARGSLSVEDER
QMDDLEGAAPPIPPRLHSEDKRKTPLKVLEEWKTHLIPSLHCAGGEQKEESYILSAELGE
KCEDIGKKLLYLEDQLHTAIHSHDEDLIQSLRRELQMVKETLQAMILQLQPAKEAGEREA
AASCMTAGVHEAQA

Sequence length

854

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (34)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPERGER SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC FATIGUE SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL COORDINATION DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISC1-related disorder	Likely benign; Uncertain significance; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISEASE OF PERITONEUM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERKINESIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTERNET ADDICTION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR SKILLS DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA 9	—	ClinVar, Disgenet ClinVar, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (130)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	18762802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	26209938, 26443054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	21739582, 23602339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34981809	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	27023224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	27052956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	17675407		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	Pubtator	24934694	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	BEFREE	28263187		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety	Anxiety disorder	Pubtator	25533973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	27916686, 28631721, 30779934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	25533973, 27916686, 28631721, 30779934		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	25533973	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	29643356		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	29643356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asperger Syndrome	Asperger Syndrome	BEFREE	17579608, 18317464, 19251251, 20002455, 21222298, 21569632		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asperger Syndrome	Asperger Syndrome	LHGDN	17579608		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asperger Syndrome	Asperger Syndrome	CTD_human_DG	17579608		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asperger Syndrome	Asperger syndrome	Pubtator	19251251, 21569632	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16997000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16997000, 23389941, 28097908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	19606485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	30461592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	17579608, 18317464, 18762802, 20002455, 21569632, 21757008, 22291444, 22434823		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	17579608		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	17579608, 20002455		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19251251, 21569632	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior Disorders	Behavior Disorders	BEFREE	29197324, 29467617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28927861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	15386212, 15838535, 16054297, 16056147, 16797264, 17185511, 17346882, 18180429, 18317464, 18685145, 18762802, 19191256, 19251251, 19255581, 19300510 View all (13 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	15386212, 19251251, 19300510, 19448849, 21091867, 21483430, 23032945, 25620115, 26301809, 28630456	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	15838535, 16814263, 16936759		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	24092329, 25012417, 25272038, 25487992, 26301809		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Borderline Personality Disorder	Borderline personality disorder	BEFREE	17673452, 23032945, 23389941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17673452, 23032945, 23389941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35833210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	31850367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Catalepsy	Catalepsy	BEFREE	25433637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar Hypoplasia	Cerebellar Hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31850367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	27601451	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Classical Lissencephaly	Lissencephaly	BEFREE	17117617, 18658164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	16603474, 17043677, 17258902, 23481583, 26062786, 26443054, 28593819, 29107702, 30488644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27629381, 28630456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32345670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital microcephaly	Congenital Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniometaphyseal Dysplasia Autosomal Dominant	Craniometaphyseal dysplasia	Pubtator	22952026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	22291444		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	PSYGENET_DG	22291444		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	29643356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17481393, 17823207, 19255581, 20850505, 21483430, 22547224, 22832659, 25224257, 25533973, 31601402		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	19300510, 21483430, 25533973, 31106784	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	22348257, 22547224, 23011268, 23602339, 25533973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	29643356		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	19251251, 19448849, 21483430, 23732877, 24934694, 28630456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	29643356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Coordination Disorder	Developmental dyspraxia	CTD_human_DG	26754951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26546129		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	25433637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	29643356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Rolandic	Epilepsy	BEFREE	22815793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	29752072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	33568133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30461592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33568133, 36397361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28263187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	22369086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	22369086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16603474, 17043677, 17258902, 17673452, 23481583, 26062786, 26443054, 28593819, 29107702, 30488644, 30617212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	CTD_human_DG	20002455		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Intellectual developmental disorder	Pubtator	22952026, 28630456	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual Disability	Mental retardation	BEFREE	28630456		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lissencephaly	Lissencephaly	BEFREE	17482883, 20207112		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	19255581, 22673686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	11443544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	19255581, 22673686		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	19255581, 22673686		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	19255581, 22673686		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	19255581		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	19255581		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	19255581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16699061, 16959794, 18762802, 18785206, 19018233, 19251251, 19255581, 19448849, 20227423, 21222298, 21757008, 23389941, 24934694, 25012417, 25043320 View all (5 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	24934694, 25043320, 25272038, 25487992, 25705664		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malformations of Cortical Development Group II	Cortical development malformation	Pubtator	18762586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	16319375, 17551090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	29643356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental deficiency	Mental retardation	CTD_human_DG	20002455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	17481393, 17823207, 19255581, 20850505, 21483430, 22547224, 22832659, 25224257, 25533973, 31601402		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	22348257, 22547224, 23011268, 23602339, 25533973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	10814723, 11317219, 12802181, 14962739, 15094396, 15386212, 15478311, 16209927, 16699061, 16843095, 17374448, 17481393, 17664024, 17823207, 17912248 View all (99 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly-polymicrogyria-corpus callosum agenesis syndrome	Microcephaly-Polymicrogyria-Corpus Callosum Agenesis Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	BEFREE	20002455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20880836	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	11443544, 15478311, 17258902, 18400883, 18474207, 19255581, 20048751, 20397618, 22547224, 23389941, 23602339, 25533973, 27354230, 28664299, 30190480		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	18474207		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	22547224, 23389941, 23602339, 23637159, 25533973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	25533973	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor Skills Disorders	Motor Skills Disorders	CTD_human_DG	26754951		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYD88 Deficiency	MYD88 Deficiency	BEFREE	27979975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22369086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22369086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	14962739, 17482883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	18400883, 30397826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22952026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	22952026, 28275106, 28720848, 31075539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	23389941, 28392471, 29961565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29029423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	16843095, 17374448, 17449450, 18395819, 19188535, 19586833, 20084519, 21878470, 22363459, 22815203, 24474471, 26102360, 26209938, 29945223, 31204062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	29635888		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	21483430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Profound Mental Retardation	Mental retardation	CTD_human_DG	20002455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	11525420, 12740602, 15522253, 16843095, 16959794, 17374448, 17449450, 17673452, 17884020, 18395819, 19188535, 19191256, 19586833, 20084519, 20227423 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	15386212, 15657124, 18762586, 19300510, 21483430, 21878470, 22363459, 24474471, 26101851, 29945223, 37668563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	24092329, 28275106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	15121183, 16843095, 22434823, 23732877		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	15184103, 15940305, 16203953, 18078707, 18317464, 18395819, 21222298		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective disorder, bipolar type	Schizoaffective Disorder	BEFREE	21445958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	10814723, 11443544, 15386212, 15657124, 18762586, 19046394, 19251251, 19300510, 19448849, 19805229, 20880836, 21091867, 21483430, 21853134, 21876540 View all (14 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	11317219, 11377748, 11443544, 11468279, 11525420, 12802181, 12812986, 12874605, 14532331, 14962739, 15121183, 15184103, 15197400, 15249933, 15342131 View all (223 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	14532331, 15184103, 15838535, 15939883, 15940305, 16056147, 16103888, 16389590, 16936759, 16997000, 17286247, 17823207, 17997036, 18078707, 18164685 View all (8 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	20531374, 20561508		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia and related disorders	Schizophrenia	BEFREE	15940305, 16699061, 16843095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Social Anhedonia	Social Anhedonia	BEFREE	19188535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	21256178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	37508512	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16699061, 16959794, 18164685, 18762802, 19018233, 19251251, 21222298, 21757008, 23389941, 24934694, 25012417, 25043320, 25595671, 29467617, 30116177, 30597994 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	24934694, 25043320, 25272038, 25487992, 25705664		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	29643356		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

DISC1 (DISC1 scaffold protein)