Gene Gene information from NCBI Gene database.
Entrez ID 27181
Gene name Sialic acid binding Ig like lectin 8
Gene symbol SIGLEC8
Synonyms (NCBI Gene)
SAF2SIGLEC-8SIGLEC8L
Chromosome 19
Chromosome location 19q13.41
Summary Sialic acid-binding immunoglobulin (Ig)-like lectins, or SIGLECs (e.g., CD33 (MIM 159590)), are a family of type 1 transmembrane proteins each having a unique expression pattern, mostly in hemopoietic cells. SIGLEC8 is a member of the CD33-like subgroup o
miRNA miRNA information provided by mirtarbase database.
320
miRTarBase ID miRNA Experiments Reference
MIRT017964 hsa-miR-335-5p Microarray 18185580
MIRT723520 hsa-miR-4324 HITS-CLIP 19536157
MIRT723519 hsa-miR-544b HITS-CLIP 19536157
MIRT723518 hsa-miR-4421 HITS-CLIP 19536157
MIRT723517 hsa-miR-5699-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11
GO ID Ontology Definition Evidence Reference
GO:0004888 Function Transmembrane signaling receptor activity TAS 10625619
GO:0005515 Function Protein binding IPI 21982860
GO:0005886 Component Plasma membrane IBA
GO:0007155 Process Cell adhesion IBA
GO:0007155 Process Cell adhesion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605639 10877 ENSG00000105366
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYZ4
Protein name Sialic acid-binding Ig-like lectin 8 (Siglec-8) (Sialoadhesin family member 2) (SAF-2)
Protein function Putative adhesion molecule that mediates sialic-acid dependent binding to blood cells (PubMed:10625619, PubMed:10856141). Preferentially binds to alpha-2,3-linked sialic acid. Also binds to alpha-2,6-linked sialic acid. The sialic acid recogniti
PDB 2N7A , 2N7B , 7QU6 , 7QUH , 7QUI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF07686 V-set 30 144 Immunoglobulin V-set domain Domain
PF13927 Ig_3 266 332 Domain
Tissue specificity TISSUE SPECIFICITY: Expressed specifically on blood cells namely basophil, mast cells and eosinophils. {ECO:0000269|PubMed:10625619, ECO:0000269|PubMed:10856141}.
Sequence
MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSD
PVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKG
SYFFRLERGSMKWSYKSQLNYKTK
QLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWA
CKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVR
LDVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLRLVCAVNSNPPARLSWTRGSL
TLCPSRSSNPGLLELPRVHVRDEGEFTCRAQN
AQGSQHISLSLSLQNEGTGTSRPVSQVT
LAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTE
SWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRET
AETQACLRNHNPSSKEVRG
Sequence length 499
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CHAGAS CARDIOMYOPATHY GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alzheimer Disease, Late Onset Alzheimer disease BEFREE 24841380
★☆☆☆☆
Found in Text Mining only
Asthma Asthma BEFREE 20087405, 22884075, 24841380
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 20087405, 30876376, 32277847 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma Pubtator 32542913 Stimulate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 33670444 Associate
★☆☆☆☆
Found in Text Mining only
Chronic eosinophilic leukemia Eosinophilic Leukemia BEFREE 21938510
★☆☆☆☆
Found in Text Mining only
Chronic Obstructive Airway Disease Chronic Obstructive Pulmonary Disease BEFREE 24841380
★☆☆☆☆
Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma Renal Carcinoma BEFREE 28619634
★☆☆☆☆
Found in Text Mining only
Dermatitis Dermatitis Pubtator 32277847 Associate
★☆☆☆☆
Found in Text Mining only
Eosinophilia, Tropical Eosinophilia BEFREE 29879704
★☆☆☆☆
Found in Text Mining only