Gene Gene information from NCBI Gene database.
Entrez ID 27177
Gene name Interleukin 36 beta
Gene symbol IL36B
Synonyms (NCBI Gene)
FIL1FIL1-(ETA)FIL1HFILI-(ETA)IL-1F8IL-1H2IL1-ETAIL1F8IL1H2
Chromosome 2
Chromosome location 2q14.1
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. Protein structure modeling indicated that this cytokine may contain a 12-stranded beta-trefoil structure that is conserved between IL1A (IL-A alpha) and IL1B (IL-1 beta). T
miRNA miRNA information provided by mirtarbase database.
33
miRTarBase ID miRNA Experiments Reference
MIRT621105 hsa-miR-1273f HITS-CLIP 23824327
MIRT612034 hsa-miR-6716-5p HITS-CLIP 23824327
MIRT612034 hsa-miR-6716-5p HITS-CLIP 23824327
MIRT612034 hsa-miR-6716-5p HITS-CLIP 23824327
MIRT612034 hsa-miR-6716-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0005125 Function Cytokine activity IBA
GO:0005125 Function Cytokine activity IEA
GO:0005149 Function Interleukin-1 receptor binding NAS 10744718
GO:0005149 Function Interleukin-1 receptor binding TAS 10625660
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605508 15564 ENSG00000136696
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NZH7
Protein name Interleukin-36 beta (FIL1 eta) (Interleukin-1 eta) (IL-1 eta) (Interleukin-1 family member 8) (IL-1F8) (Interleukin-1 homolog 2) (IL-1H2)
Protein function Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expression at low levels in tonsil, bone marrow, heart, placenta, lung, testis and colon but not in any hematopoietic cell lines. Not detected in adipose tissue. Expressed at higher levels in psoriatic plaques than in symptomless psori
Sequence
MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGN
MVYLGIKGKDLCLFCAEIQGKPTLQLKLQGSQDNIGKDTCWKLVGIHTCINLDVRESCFM
GTLDQWGIGVGRKKWKSSFQHHHLRKKDKDFSSMRTNIGMPGRM
Sequence length 164
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction   Interleukin-36 pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
High myopia Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arthritis Psoriatic Psoriatic arthritis Pubtator 16918024 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 32013927 Associate
★☆☆☆☆
Found in Text Mining only
Dermatitis Atopic Atopic dermatitis Pubtator 37446281 Associate
★☆☆☆☆
Found in Text Mining only
Ichthyoses Ichthyosis BEFREE 29803800
★☆☆☆☆
Found in Text Mining only
Ichthyosis Ichthyosis Pubtator 29803800 Associate
★☆☆☆☆
Found in Text Mining only
Ichthyosis linearis circumflexa Netherton syndrome BEFREE 29803800
★☆☆☆☆
Found in Text Mining only
Inflammatory Bowel Diseases Inflammatory bowel disease Pubtator 30643810 Associate
★☆☆☆☆
Found in Text Mining only
Macular Degeneration Macular degeneration Pubtator 33115414 Stimulate
★☆☆☆☆
Found in Text Mining only
Psoriasis Psoriasis BEFREE 29803800
★☆☆☆☆
Found in Text Mining only
Psoriasis Psoriasis Pubtator 29803800 Associate
★☆☆☆☆
Found in Text Mining only