TUBG2 (tubulin gamma 2)

Gene

• Entrez ID: 27175
• Gene name: Tubulin gamma 2
• Gene symbol: TUBG2
• Synonyms (NCBI Gene): -
• Chromosome: 17
• Chromosome location: 17q21.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1463548	hsa-miR-1273g	CLIP-seq
MIRT1463549	hsa-miR-127-5p	CLIP-seq
MIRT1463550	hsa-miR-3154	CLIP-seq
MIRT1463551	hsa-miR-320e	CLIP-seq
MIRT1463552	hsa-miR-3622b-5p	CLIP-seq
MIRT1463553	hsa-miR-409-5p	CLIP-seq
MIRT1463554	hsa-miR-4257	CLIP-seq
MIRT1463555	hsa-miR-4419a	CLIP-seq
MIRT1463556	hsa-miR-4510	CLIP-seq
MIRT1463557	hsa-miR-4690-5p	CLIP-seq
MIRT1463558	hsa-miR-485-5p	CLIP-seq
MIRT2653339	hsa-miR-1270	CLIP-seq
MIRT2653340	hsa-miR-1286	CLIP-seq
MIRT2653341	hsa-miR-1296	CLIP-seq
MIRT2653342	hsa-miR-1321	CLIP-seq
MIRT2653343	hsa-miR-143	CLIP-seq
MIRT2653344	hsa-miR-2909	CLIP-seq
MIRT2653345	hsa-miR-296-3p	CLIP-seq
MIRT2653346	hsa-miR-3135b	CLIP-seq
MIRT1463550	hsa-miR-3154	CLIP-seq
MIRT2653347	hsa-miR-3160-3p	CLIP-seq
MIRT2653348	hsa-miR-3202	CLIP-seq
MIRT1463552	hsa-miR-3622b-5p	CLIP-seq
MIRT2653349	hsa-miR-3652	CLIP-seq
MIRT2653350	hsa-miR-4253	CLIP-seq
MIRT2653351	hsa-miR-4267	CLIP-seq
MIRT2653352	hsa-miR-4430	CLIP-seq
MIRT2653353	hsa-miR-4436b-3p	CLIP-seq
MIRT2653354	hsa-miR-4492	CLIP-seq
MIRT2653355	hsa-miR-4498	CLIP-seq
MIRT2653356	hsa-miR-4533	CLIP-seq
MIRT2653357	hsa-miR-4683	CLIP-seq
MIRT2653358	hsa-miR-4739	CLIP-seq
MIRT2653359	hsa-miR-4756-5p	CLIP-seq
MIRT2653360	hsa-miR-4761-3p	CLIP-seq
MIRT2653361	hsa-miR-4770	CLIP-seq
MIRT2653362	hsa-miR-548n	CLIP-seq
MIRT2653363	hsa-miR-548t	CLIP-seq
MIRT2653364	hsa-miR-549	CLIP-seq
MIRT2653365	hsa-miR-556-3p	CLIP-seq
MIRT2653366	hsa-miR-620	CLIP-seq
MIRT2653367	hsa-miR-762	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000070	Process	Mitotic sister chromatid segregation	IBA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000212	Process	Meiotic spindle organization	IBA
GO:0000242	Component	Pericentriolar material	IEA
GO:0000278	Process	Mitotic cell cycle	IBA
GO:0000930	Component	Gamma-tubulin complex	IEA
GO:0000931	Component	Gamma-tubulin ring complex	IBA
GO:0005198	Function	Structural molecule activity	TAS	10903841
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IEA
GO:0005819	Component	Spindle	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	21525035
GO:0005874	Component	Microtubule	IEA
GO:0005876	Component	Spindle microtubule	IEA
GO:0005881	Component	Cytoplasmic microtubule	IEA
GO:0007017	Process	Microtubule-based process	IEA
GO:0007020	Process	Microtubule nucleation	IBA
GO:0007020	Process	Microtubule nucleation	IEA
GO:0007052	Process	Mitotic spindle organization	IBA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0015630	Component	Microtubule cytoskeleton	TAS	10903841
GO:0031122	Process	Cytoplasmic microtubule organization	IEA
GO:0140490	Function	Microtubule nucleator activity	IBA

Other IDs

• MIM: 605785
• HGNC: 12419
• e!Ensembl: ENSG00000037042

Protein

• UniProt ID: Q9NRH3
• Protein name: Tubulin gamma-2 chain (Gamma-2-tubulin)
• Protein function: Tubulin is the major constituent of microtubules, protein filaments consisting of alpha- and beta-tubulin heterodimers (PubMed:38305685). Gamma-tubulin is a key component of the gamma-tubulin ring complex (gTuRC) which mediates microtubule nucle
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00091	Tubulin	4 → 215	Tubulin/FtsZ family, GTPase domain	Domain
  PF03953	Tubulin_C	264 → 393	Tubulin C-terminal domain	Domain

• Sequence:

  MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
  IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
  IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSD
  VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
  TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
  KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
  SRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE
  MDRSREVVQELIDEYHAATQPDYISWGTQEQ

• Sequence length: 451

Pathways

KEGG:

Motor proteins
Human papillomavirus infection

Reactome:

Recruitment of mitotic centrosome proteins and complexes
Recruitment of NuMA to mitotic centrosomes

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Astrocytoma	Astrocytoma	Pubtator	18670637	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	36672848	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	36672848	Associate	★☆☆☆☆ Found in Text Mining only
Perisylvian syndrome	Perisylvian syndrome	Pubtator	36672848	Associate	★☆☆☆☆ Found in Text Mining only
Polymicrogyria	Polymicrogyria	Pubtator	36672848	Associate	★☆☆☆☆ Found in Text Mining only