Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27166
Gene name	PRELI domain containing 1
Gene symbol	PRELID1
Synonyms (NCBI Gene)	CGI-106PRELIPX19SBBI12
Chromosome	5
Chromosome location	5q35.3
Summary	This gene encodes a member of the late embryogenesis abundant motif-containing protein family. The encoded protein is localized to mitochondria and may function as a cytoprotectant by regulating cell death and differentiation. Alternative splicing results

144

Show/Hide all (144)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021703	hsa-miR-133a-3p	Microarray	21396852
MIRT049816	hsa-miR-92a-3p	CLASH	23622248
MIRT038580	hsa-miR-106b-3p	CLASH	23622248
MIRT545066	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT545065	hsa-miR-548ab	PAR-CLIP	21572407
MIRT545064	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT545063	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT545062	hsa-miR-548ak	PAR-CLIP	21572407
MIRT545061	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT545060	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT545059	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT545058	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT545057	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT545056	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT545055	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT545054	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT545053	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT545052	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT545051	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT545050	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT545049	hsa-miR-548i	PAR-CLIP	21572407
MIRT545048	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT545047	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT545046	hsa-miR-548w	PAR-CLIP	21572407
MIRT545045	hsa-miR-548y	PAR-CLIP	21572407
MIRT545044	hsa-miR-559	PAR-CLIP	21572407
MIRT545043	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT545042	hsa-miR-548k	PAR-CLIP	21572407
MIRT545041	hsa-miR-8054	PAR-CLIP	21572407
MIRT545040	hsa-miR-548l	PAR-CLIP	21572407
MIRT545039	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT545038	hsa-miR-4446-3p	PAR-CLIP	21572407
MIRT545037	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT545036	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT545035	hsa-miR-3652	PAR-CLIP	21572407
MIRT545034	hsa-miR-4430	PAR-CLIP	21572407
MIRT545033	hsa-miR-4492	PAR-CLIP	21572407
MIRT545032	hsa-miR-4498	PAR-CLIP	21572407
MIRT545031	hsa-miR-5001-5p	PAR-CLIP	21572407
MIRT545030	hsa-miR-762	PAR-CLIP	21572407
MIRT439903	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439903	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT545066	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT545065	hsa-miR-548ab	PAR-CLIP	21572407
MIRT545064	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT545063	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT545062	hsa-miR-548ak	PAR-CLIP	21572407
MIRT545061	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT545060	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT545059	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT545058	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT545057	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT545056	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT545055	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT545054	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT545053	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT545052	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT545051	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT545050	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT545049	hsa-miR-548i	PAR-CLIP	21572407
MIRT545048	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT545047	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT545046	hsa-miR-548w	PAR-CLIP	21572407
MIRT545045	hsa-miR-548y	PAR-CLIP	21572407
MIRT545044	hsa-miR-559	PAR-CLIP	21572407
MIRT545043	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT545042	hsa-miR-548k	PAR-CLIP	21572407
MIRT545041	hsa-miR-8054	PAR-CLIP	21572407
MIRT545040	hsa-miR-548l	PAR-CLIP	21572407
MIRT545039	hsa-miR-580-5p	PAR-CLIP	21572407
MIRT545038	hsa-miR-4446-3p	PAR-CLIP	21572407
MIRT545037	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT545036	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT545035	hsa-miR-3652	PAR-CLIP	21572407
MIRT545034	hsa-miR-4430	PAR-CLIP	21572407
MIRT545033	hsa-miR-4492	PAR-CLIP	21572407
MIRT545032	hsa-miR-4498	PAR-CLIP	21572407
MIRT545031	hsa-miR-5001-5p	PAR-CLIP	21572407
MIRT545030	hsa-miR-762	PAR-CLIP	21572407
MIRT1260721	hsa-miR-1231	CLIP-seq
MIRT1260722	hsa-miR-3120-5p	CLIP-seq
MIRT1260723	hsa-miR-323-5p	CLIP-seq
MIRT1260724	hsa-miR-342-5p	CLIP-seq
MIRT1260725	hsa-miR-4651	CLIP-seq
MIRT1260726	hsa-miR-4664-5p	CLIP-seq
MIRT1260727	hsa-miR-4667-5p	CLIP-seq
MIRT1260728	hsa-miR-4700-5p	CLIP-seq
MIRT1260729	hsa-miR-608	CLIP-seq
MIRT1260730	hsa-miR-626	CLIP-seq
MIRT1260731	hsa-miR-637	CLIP-seq
MIRT1260732	hsa-miR-876-3p	CLIP-seq
MIRT2076719	hsa-miR-3173-5p	CLIP-seq
MIRT2076720	hsa-miR-3919	CLIP-seq
MIRT2076721	hsa-miR-3925-5p	CLIP-seq
MIRT2076722	hsa-miR-4329	CLIP-seq
MIRT2076723	hsa-miR-4756-3p	CLIP-seq
MIRT2076724	hsa-miR-548aa	CLIP-seq
MIRT2076725	hsa-miR-642b	CLIP-seq
MIRT2303432	hsa-miR-1207-3p	CLIP-seq
MIRT2303433	hsa-miR-22	CLIP-seq
MIRT2303434	hsa-miR-224	CLIP-seq
MIRT2303435	hsa-miR-4746-5p	CLIP-seq
MIRT2303436	hsa-miR-550a	CLIP-seq
MIRT1260723	hsa-miR-323-5p	CLIP-seq
MIRT1260724	hsa-miR-342-5p	CLIP-seq
MIRT2465903	hsa-miR-3529	CLIP-seq
MIRT2465904	hsa-miR-379	CLIP-seq
MIRT2465905	hsa-miR-4451	CLIP-seq
MIRT2465906	hsa-miR-4536	CLIP-seq
MIRT2465907	hsa-miR-4650-3p	CLIP-seq
MIRT1260725	hsa-miR-4651	CLIP-seq
MIRT1260726	hsa-miR-4664-5p	CLIP-seq
MIRT1260727	hsa-miR-4667-5p	CLIP-seq
MIRT1260728	hsa-miR-4700-5p	CLIP-seq
MIRT1260729	hsa-miR-608	CLIP-seq
MIRT1260731	hsa-miR-637	CLIP-seq
MIRT1260732	hsa-miR-876-3p	CLIP-seq
MIRT2076719	hsa-miR-3173-5p	CLIP-seq
MIRT2600005	hsa-miR-3655	CLIP-seq
MIRT2076720	hsa-miR-3919	CLIP-seq
MIRT2076721	hsa-miR-3925-5p	CLIP-seq
MIRT2600006	hsa-miR-3944-3p	CLIP-seq
MIRT2076723	hsa-miR-4756-3p	CLIP-seq
MIRT2076724	hsa-miR-548aa	CLIP-seq
MIRT2600007	hsa-miR-582-5p	CLIP-seq
MIRT2600008	hsa-miR-600	CLIP-seq
MIRT2076725	hsa-miR-642b	CLIP-seq
MIRT2600009	hsa-miR-938	CLIP-seq
MIRT2688557	hsa-miR-1205	CLIP-seq
MIRT2076719	hsa-miR-3173-5p	CLIP-seq
MIRT2600005	hsa-miR-3655	CLIP-seq
MIRT2076720	hsa-miR-3919	CLIP-seq
MIRT2076721	hsa-miR-3925-5p	CLIP-seq
MIRT2600006	hsa-miR-3944-3p	CLIP-seq
MIRT2688558	hsa-miR-4254	CLIP-seq
MIRT2076723	hsa-miR-4756-3p	CLIP-seq
MIRT2688559	hsa-miR-490-3p	CLIP-seq
MIRT2076724	hsa-miR-548aa	CLIP-seq
MIRT2600007	hsa-miR-582-5p	CLIP-seq
MIRT2600008	hsa-miR-600	CLIP-seq
MIRT2688560	hsa-miR-619	CLIP-seq
MIRT2076725	hsa-miR-642b	CLIP-seq
MIRT2688561	hsa-miR-649	CLIP-seq
MIRT2600009	hsa-miR-938	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21364629, 23931759
GO:0005654	Component	Nucleoplasm	IDA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	ISS
GO:0005758	Component	Mitochondrial intermembrane space	IBA
GO:0005758	Component	Mitochondrial intermembrane space	IDA	21364629
GO:0005758	Component	Mitochondrial intermembrane space	IEA
GO:0005758	Component	Mitochondrial intermembrane space	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IDA	18945965
GO:0010950	Process	Positive regulation of endopeptidase activity	IDA	18945965
GO:0015914	Process	Phospholipid transport	IBA
GO:0032991	Component	Protein-containing complex	IDA	23931759
GO:0043066	Process	Negative regulation of apoptotic process	IDA	21364629
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IMP	23931759
GO:0045580	Process	Regulation of T cell differentiation	IDA	18945965
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	21364629
GO:0070234	Process	Positive regulation of T cell apoptotic process	IDA	18945965
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IDA	23931759
GO:0097035	Process	Regulation of membrane lipid distribution	IDA	23931759
GO:0120009	Process	Intermembrane lipid transfer	IEA
GO:1901857	Process	Positive regulation of cellular respiration	IDA	21364629, 23931759
GO:1990050	Function	Phosphatidic acid transfer activity	IMP	23931759
GO:2001140	Process	Positive regulation of phospholipid transport	IDA	23931759

MIM	HGNC	e!Ensembl
605733	30255	ENSG00000169230

Q9Y255

Protein name

PRELI domain-containing protein 1, mitochondrial (25 kDa protein of relevant evolutionary and lymphoid interest) (Px19-like protein)

Protein function

Involved in the modulation of the mitochondrial apoptotic pathway by ensuring the accumulation of cardiolipin (CL) in mitochondrial membranes. In vitro, the TRIAP1:PRELID1 complex mediates the transfer of phosphatidic acid (PA) between liposomes

PDB

6I3V , 6I3Y

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04707	PRELI	16 → 172	PRELI-like family	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in fetal liver; less expressed in fetal brain, lung, and kidney. At the adult stage, expression is drastically reduced in the liver but highly expressed in the spleen, brain, lung, lymph nodes and peripheral blood leuk

Sequence

MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTN
RMPRWAERLFPANVAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDN
SGWTEIRREAWVSSSLFGVSRAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVE
TAKEAKEKAKETALAATEKAKDLASKAATKKQQQQQQFV

Sequence length

219

Interactions

View interactions

	Reactome
			TP53 Regulates Transcription of Genes Involved in Cytochrome C Release

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	28912168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39769068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28912168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	26932277	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26932277	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRELID1 (PRELI domain containing 1)