Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27148
Gene name	Serine/threonine kinase 36
Gene symbol	STK36
Synonyms (NCBI Gene)	CILD46FU
Chromosome	2
Chromosome location	2q35
Summary	This gene encodes a member of the serine/threonine kinase family of enzymes. This family member is similar to a Drosophila protein that plays a key role in the Hedgehog signaling pathway. This human protein is a positive regulator of the GLI zinc-finger t

130

Show/Hide all (130)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022162	hsa-miR-124-3p	Microarray	18668037
MIRT614439	hsa-miR-8485	HITS-CLIP	23824327
MIRT614438	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614437	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629817	hsa-miR-603	HITS-CLIP	23824327
MIRT614436	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614435	hsa-miR-3941	HITS-CLIP	23824327
MIRT614434	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT614439	hsa-miR-8485	HITS-CLIP	23824327
MIRT614438	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614437	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614436	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614435	hsa-miR-3941	HITS-CLIP	23824327
MIRT614434	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT734321	hsa-miR-21-5p	ImmunofluorescenceqRT-PCRRNA-seqWestern blotting	31735554
MIRT734322	hsa-miR-146b-3p	ImmunofluorescenceqRT-PCRRNA-seqWestern blotting	31735554
MIRT734323	hsa-miR-5571-3p	ImmunofluorescenceqRT-PCRRNA-seqWestern blotting	31735554
MIRT734324	hsa-miR-6503-3p	ImmunofluorescenceqRT-PCRRNA-seqWestern blotting	31735554
MIRT614439	hsa-miR-8485	HITS-CLIP	23824327
MIRT614438	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614437	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629817	hsa-miR-603	HITS-CLIP	23824327
MIRT614436	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614435	hsa-miR-3941	HITS-CLIP	23824327
MIRT614434	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT614439	hsa-miR-8485	HITS-CLIP	23824327
MIRT614438	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT614437	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT614436	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT614435	hsa-miR-3941	HITS-CLIP	23824327
MIRT614434	hsa-miR-4789-5p	HITS-CLIP	23824327
MIRT1397927	hsa-miR-124	CLIP-seq
MIRT1397928	hsa-miR-1343	CLIP-seq
MIRT1397929	hsa-miR-329	CLIP-seq
MIRT1397930	hsa-miR-3714	CLIP-seq
MIRT1397931	hsa-miR-3910	CLIP-seq
MIRT1397932	hsa-miR-4521	CLIP-seq
MIRT1397933	hsa-miR-4640-5p	CLIP-seq
MIRT1397934	hsa-miR-4726-5p	CLIP-seq
MIRT1397935	hsa-miR-506	CLIP-seq
MIRT2119282	hsa-miR-2117	CLIP-seq
MIRT2119283	hsa-miR-3163	CLIP-seq
MIRT2119284	hsa-miR-4264	CLIP-seq
MIRT2119285	hsa-miR-4273	CLIP-seq
MIRT2119286	hsa-miR-4677-5p	CLIP-seq
MIRT2119287	hsa-miR-4797-3p	CLIP-seq
MIRT2119288	hsa-miR-578	CLIP-seq
MIRT1397927	hsa-miR-124	CLIP-seq
MIRT2341457	hsa-miR-1297	CLIP-seq
MIRT1397928	hsa-miR-1343	CLIP-seq
MIRT2341458	hsa-miR-2355-3p	CLIP-seq
MIRT2341459	hsa-miR-26a	CLIP-seq
MIRT2341460	hsa-miR-26b	CLIP-seq
MIRT2341461	hsa-miR-3192	CLIP-seq
MIRT2341462	hsa-miR-4300	CLIP-seq
MIRT2341463	hsa-miR-4465	CLIP-seq
MIRT2341464	hsa-miR-4484	CLIP-seq
MIRT1397935	hsa-miR-506	CLIP-seq
MIRT2341465	hsa-miR-520d-5p	CLIP-seq
MIRT2341466	hsa-miR-524-5p	CLIP-seq
MIRT2341467	hsa-miR-548an	CLIP-seq
MIRT2341468	hsa-miR-676	CLIP-seq
MIRT2341469	hsa-miR-920	CLIP-seq
MIRT2395353	hsa-miR-581	CLIP-seq
MIRT2635416	hsa-miR-1208	CLIP-seq
MIRT1397927	hsa-miR-124	CLIP-seq
MIRT1397928	hsa-miR-1343	CLIP-seq
MIRT2635417	hsa-miR-28-5p	CLIP-seq
MIRT2635418	hsa-miR-3120-5p	CLIP-seq
MIRT2635419	hsa-miR-3139	CLIP-seq
MIRT2635420	hsa-miR-3155	CLIP-seq
MIRT2635421	hsa-miR-3155b	CLIP-seq
MIRT2635422	hsa-miR-370	CLIP-seq
MIRT1397930	hsa-miR-3714	CLIP-seq
MIRT1397931	hsa-miR-3910	CLIP-seq
MIRT2635423	hsa-miR-4438	CLIP-seq
MIRT1397932	hsa-miR-4521	CLIP-seq
MIRT1397933	hsa-miR-4640-5p	CLIP-seq
MIRT2635424	hsa-miR-4646-5p	CLIP-seq
MIRT2635425	hsa-miR-4699-5p	CLIP-seq
MIRT1397934	hsa-miR-4726-5p	CLIP-seq
MIRT2635426	hsa-miR-4731-5p	CLIP-seq
MIRT2635427	hsa-miR-4747-5p	CLIP-seq
MIRT2635428	hsa-miR-484	CLIP-seq
MIRT1397935	hsa-miR-506	CLIP-seq
MIRT2635429	hsa-miR-548ac	CLIP-seq
MIRT2635430	hsa-miR-548d-3p	CLIP-seq
MIRT2635431	hsa-miR-548z	CLIP-seq
MIRT2635432	hsa-miR-708	CLIP-seq
MIRT2635433	hsa-miR-760	CLIP-seq
MIRT2635416	hsa-miR-1208	CLIP-seq
MIRT1397927	hsa-miR-124	CLIP-seq
MIRT2692258	hsa-miR-1252	CLIP-seq
MIRT1397928	hsa-miR-1343	CLIP-seq
MIRT2635417	hsa-miR-28-5p	CLIP-seq
MIRT2692259	hsa-miR-3120-3p	CLIP-seq
MIRT2635418	hsa-miR-3120-5p	CLIP-seq
MIRT2635419	hsa-miR-3139	CLIP-seq
MIRT2635420	hsa-miR-3155	CLIP-seq
MIRT2635421	hsa-miR-3155b	CLIP-seq
MIRT2119283	hsa-miR-3163	CLIP-seq
MIRT2341461	hsa-miR-3192	CLIP-seq
MIRT2635422	hsa-miR-370	CLIP-seq
MIRT1397930	hsa-miR-3714	CLIP-seq
MIRT1397931	hsa-miR-3910	CLIP-seq
MIRT2692260	hsa-miR-3942-5p	CLIP-seq
MIRT2692261	hsa-miR-4282	CLIP-seq
MIRT2692262	hsa-miR-4314	CLIP-seq
MIRT2692263	hsa-miR-4434	CLIP-seq
MIRT2635423	hsa-miR-4438	CLIP-seq
MIRT2692264	hsa-miR-4516	CLIP-seq
MIRT1397932	hsa-miR-4521	CLIP-seq
MIRT1397933	hsa-miR-4640-5p	CLIP-seq
MIRT2635424	hsa-miR-4646-5p	CLIP-seq
MIRT2692265	hsa-miR-4699-3p	CLIP-seq
MIRT2635425	hsa-miR-4699-5p	CLIP-seq
MIRT2692266	hsa-miR-4703-5p	CLIP-seq
MIRT1397934	hsa-miR-4726-5p	CLIP-seq
MIRT2635426	hsa-miR-4731-5p	CLIP-seq
MIRT2635427	hsa-miR-4747-5p	CLIP-seq
MIRT2692267	hsa-miR-4793-5p	CLIP-seq
MIRT2635428	hsa-miR-484	CLIP-seq
MIRT1397935	hsa-miR-506	CLIP-seq
MIRT2635429	hsa-miR-548ac	CLIP-seq
MIRT2635430	hsa-miR-548d-3p	CLIP-seq
MIRT2635431	hsa-miR-548z	CLIP-seq
MIRT2692268	hsa-miR-563	CLIP-seq
MIRT2692269	hsa-miR-570	CLIP-seq
MIRT2635432	hsa-miR-708	CLIP-seq
MIRT2635433	hsa-miR-760	CLIP-seq

Show/Hide all (40)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001222	Function	Transcription corepressor binding	IDA	10806483
GO:0003351	Process	Epithelial cilium movement involved in extracellular fluid movement	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	31279575
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10806483
GO:0005515	Function	Protein binding	IPI	10806483, 25241761, 32707033, 32814053, 37584603
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	TAS	10806483
GO:0005576	Component	Extracellular region	IEA
GO:0005634	Component	Nucleus	IDA	10806483
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10806483
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	TAS	10806483
GO:0007017	Process	Microtubule-based process	IEA
GO:0007224	Process	Smoothened signaling pathway	IBA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0007224	Process	Smoothened signaling pathway	IMP	31279575
GO:0007224	Process	Smoothened signaling pathway	ISS
GO:0007420	Process	Brain development	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0009791	Process	Post-embryonic development	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0035082	Process	Axoneme assembly	IMP	28543983
GO:0042995	Component	Cell projection	IEA
GO:0045880	Process	Positive regulation of smoothened signaling pathway	IEA
GO:0045880	Process	Positive regulation of smoothened signaling pathway	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051090	Process	Regulation of DNA-binding transcription factor activity	IDA	10806483
GO:0060271	Process	Cilium assembly	IEA
GO:0060271	Process	Cilium assembly	IMP	28543983
GO:0060271	Process	Cilium assembly	ISS
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
607652	17209	ENSG00000163482

Q9NRP7

Protein name

Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused homolog)

Protein function

Serine/threonine protein kinase which plays an important role in the sonic hedgehog (Shh) pathway by regulating the activity of GLI transcription factors (PubMed:10806483). Controls the activity of the transcriptional regulators GLI1, GLI2 and G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	4 → 254	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed at low levels in most fetal tissues, adult ovaries and at high levels in adult testis, where it is localized in germ cells (PubMed:10806483). Expressed in respiratory epithelial cells of the lung (PubMed:28543983). {ECO:00002

Sequence

MEKYHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLRH
PNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHR
ILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHT
ADLWSVGCILYELAVGTPPFYATSIFQLVSLILKDPVRWPSTISPCFKNFLQGLLTKDPR
QRLSWPDLLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSR
ILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGTAPLPRLGATPQESSLLAGILAS
ELKSSWAKSGTGEVPSAPRENRTTPDCERAFPEERPEVLGQRSTDVVDLENEEPDSDNEW
QHLLETTEPVPIQLKAPLTLLCNPDFCQRIQSQLHEAGGQILKGILEGASHILPAFRVLS
SLLSSCSDSVALYSFCREAGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFA
CTFNLERSQTSDSLQVFQEAANLFLDLLGKLLAQPDDSEQTLRRDSLMCFTVLCEAMDGN
SRAISKAFYSSLLTTQQVVLDGLLHGLTVPQLPVHTPQGAPQVSQPLREQSEDIPGAISS
ALAAICTAPVGLPDCWDAKEQVCWHLANQLTEDSSQLRPSLISGLQHPILCLHLLKVLYS
CCLVSEGLCRLLGQEPLALESLFMLIQGKVKVVDWEESTEVTLYFLSLLVFRLQNLPCGM
EKLGSDVATLFTHSHVVSLVSAAACLLGQLGQQGVTFDLQPMEWMAAATHALSAPAEVRL
TPPGSCGFYDGLLILLLQLLTEQGKASLIRDMSSSEMWTVLWHRFSMVLRLPEEASAQEG
ELSLSSPPSPEPDWTLISPQGMAALLSLAMATFTQEPQLCLSCLSQHGSILMSILKHLLC
PSFLNQLRQAPHGSEFLPVVVLSVCQLLCFPFALDMDADLLIGVLADLRDSEVAAHLLQV
CCYHLPLMQVELPISLLTRLALMDPTSLNQFVNTVSASPRTIVSFLSVALLSDQPLLTSD
LLSLLAHTARVLSPSHLSFIQELLAGSDESYRPLRSLLGHPENSVRAHTYRLLGHLLQHS
MALRGALQSQSGLLSLLLLGLGDKDPVVRCSASFAVGNAAYQAGPLGPALAAAVPSMTQL
LGDPQAGIRRNVASALGNLGPEGLGEELLQCEVPQRLLEMACGDPQPNVKEAALIALRSL
QQEPGIHQVLVSLGASEKLSLLSLGNQSLPHSSPRPASAKHCRKLIHLLRPAHSM

Sequence length

1315

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Ciliary dyskinesia, primary, 46	Pathogenic	rs763400883	RCV001535817	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY MOTILITY DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CILIARY DYSKINESIA	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STK36-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASCAT_DG	22959728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	GWASDB_DG	22959728		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthenozoospermia	Asthenozoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchitis, Chronic	Gastric Cancer	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliary Dyskinesia, Primary, 1, With Or Without Situs Inversus	Ciliary Dyskinesia	ORPHANET_DG	28543983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital absence of spleen	Asplenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital pectus excavatum	Congenital Pectus Excavatum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hydrocephalus	Hydrocephalus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Kartagener Syndrome	BEFREE	28543983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kartagener Syndrome	Kartagener Syndrome	ORPHANET_DG	28543983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17089004		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media with Effusion	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polynesian Bronchiectasis	Kartagener syndrome	ORPHANET_DG	28543983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	28543983		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary Ciliary Dyskinesia	Ciliary dyskinesia	ORPHANET_DG	28543983		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary ciliary dyskinesia	Ciliary dyskinesia	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38184689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Situs inversus totalis	Situs Inversus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only

STK36 (serine/threonine kinase 36)