Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27143
Gene name	Phosphatase domain containing paladin 1
Gene symbol	PALD1
Synonyms (NCBI Gene)	KIAA1274PALD
Chromosome	10
Chromosome location	10q22.1

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020931	hsa-miR-155-5p	Other	18262046
MIRT020931	hsa-miR-155-5p	Reporter assay;Other	20584899
MIRT052627	hsa-let-7a-5p	CLASH	23622248
MIRT052051	hsa-let-7b-5p	CLASH	23622248
MIRT048127	hsa-miR-197-3p	CLASH	23622248
MIRT042662	hsa-miR-196b-5p	CLASH	23622248
MIRT649580	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649579	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649578	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649577	hsa-miR-5193	HITS-CLIP	23824327
MIRT649576	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT649575	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT649574	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT649573	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT649571	hsa-miR-3671	HITS-CLIP	23824327
MIRT649572	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT649570	hsa-miR-4665-3p	HITS-CLIP	23824327
MIRT649569	hsa-miR-607	HITS-CLIP	23824327
MIRT649568	hsa-miR-1305	HITS-CLIP	23824327
MIRT649580	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649579	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649578	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649577	hsa-miR-5193	HITS-CLIP	23824327
MIRT649576	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT649575	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT649574	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT649573	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT649571	hsa-miR-3671	HITS-CLIP	23824327
MIRT649572	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT649570	hsa-miR-4665-3p	HITS-CLIP	23824327
MIRT649569	hsa-miR-607	HITS-CLIP	23824327
MIRT649568	hsa-miR-1305	HITS-CLIP	23824327
MIRT649580	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649579	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649578	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649577	hsa-miR-5193	HITS-CLIP	23824327
MIRT649576	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT649575	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT649574	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT649573	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT649571	hsa-miR-3671	HITS-CLIP	23824327
MIRT649572	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT649570	hsa-miR-4665-3p	HITS-CLIP	23824327
MIRT649569	hsa-miR-607	HITS-CLIP	23824327
MIRT649568	hsa-miR-1305	HITS-CLIP	23824327
MIRT649580	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT649579	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT649578	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT649577	hsa-miR-5193	HITS-CLIP	23824327
MIRT649576	hsa-miR-1234-3p	HITS-CLIP	23824327
MIRT649575	hsa-miR-7107-5p	HITS-CLIP	23824327
MIRT649574	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT649573	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT649571	hsa-miR-3671	HITS-CLIP	23824327
MIRT649572	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT649570	hsa-miR-4665-3p	HITS-CLIP	23824327
MIRT649569	hsa-miR-607	HITS-CLIP	23824327
MIRT649568	hsa-miR-1305	HITS-CLIP	23824327

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0005515	Function	Protein binding	IPI	21903422
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	22354871
GO:0005829	Component	Cytosol	IEA

MIM	HGNC	e!Ensembl
614656	23530	ENSG00000107719

Q9ULE6

Protein name

Paladin

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14566	PTPlike_phytase	161 → 330		Domain
PF14566	PTPlike_phytase	545 → 679		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in endothelial cells, and in certain larger vessels, in mural cells. In the brain, possibly expressed in microglia. Expressed in peripheral blood mononuclear cells (at protein level). {ECO:0000269|PubMed:22354871}.

Sequence

MGTTASTAQQTVSAGTPFEGLQGSGTMDSRHSVSIHSFQSTSLHNSKAKSIIPNKVAPVV
ITYNCKEEFQIHDELLKAHYTLGRLSDNTPEHYLVQGRYFLVRDVTEKMDVLGTVGSCGA
PNFRQVQGGLTVFGMGQPSLSGFRRVLQKLQKDGHRECVIFCVREEPVLFLRADEDFVSY
TPRDKQNLHENLQGLGPGVRVESLELAIRKEIHDFAQLSENTYHVYHNTEDLWGEPHAVA
IHGEDDLHVTEEVYKRPLFLQPTYRYHRLPLPEQGSPLEAQLDAFVSVLRETPSLLQLRD
AHGPPPALVFSCQMGVGRTNLGMVLGTLILLHRSGTTSQPEAAPTQAKPLPMEQFQVIQS
FLRMVPQGRRMVEEVDRAITACAELHDLKEVVLENQKKLEGIRPESPAQGSGSRHSVWQR
ALWSLERYFYLILFNYYLHEQYPLAFALSFSRWLCAHPELYRLPVTLSSAGPVAPRDLIA
RGSLREDDLVSPDALSTVREMDVANFRRVPRMPIYGTAQPSAKALGSILAYLTDAKRRLR
KVVWVSLREEAVLECDGHTYSLRWPGPPVAPDQLETLEAQLKAHLSEPPPGKEGPLTYRF
QTCLTMQEVFSQHRRACPGLTYHRIPMPDFCAPREEDFDQLLEALRAALSKDPGTGFVFS
CLSGQGRTTTAMVVAVLAFWHIQGFPEVGEEELVSVPDAKFTKGEFQVVMKVVQLLPDGH
RVKKEVDAALDTVSETMTPMHYHLREIIICTYRQAKAAKEAQEMRRLQLRSLQYLERYVC
LILFNAYLHLEKADSWQRPFSTWMQEVASKAGIYEILNELGFPELESGEDQPFSRLRYRW
QEQSCSLEPSAPEDLL

Sequence length

856

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARPAL TUNNEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOID LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17404500, 26333695		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28351381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19205907, 21054356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19205907, 21054356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20471940, 21519185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34313325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20811713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	20811713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26973246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21054356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30130595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29720549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	25573828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20471940, 21519185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	17194196, 17404500, 17415588, 17992582, 18818508, 19336541, 19349734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22291919, 26973246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20811713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17194196, 18978809, 26333695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	17194196, 17404500, 17415588, 17992582, 18818508, 19336541, 19349734		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma, familial	Pancreatic carcinoma	BEFREE	17194196, 17415588, 19336541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	20436683, 26333695		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	20436683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	29133847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	25573828		★★★★★ ★☆☆☆☆ Found in Text Mining only

PALD1 (phosphatase domain containing paladin 1)