Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27141
Gene name	Cell death inducing DFFA like effector b
Gene symbol	CIDEB
Synonyms (NCBI Gene)	-
Chromosome	14
Chromosome location	14q12

Show/Hide all (13)

miRTarBase ID	miRNA	Experiments
MIRT2386098	hsa-miR-1262	CLIP-seq
MIRT2386099	hsa-miR-1293	CLIP-seq
MIRT2386100	hsa-miR-2110	CLIP-seq
MIRT2386101	hsa-miR-4271	CLIP-seq
MIRT2386102	hsa-miR-4483	CLIP-seq
MIRT2386103	hsa-miR-4701-3p	CLIP-seq
MIRT2386104	hsa-miR-4725-3p	CLIP-seq
MIRT2386105	hsa-miR-491-5p	CLIP-seq
MIRT2447070	hsa-miR-3127-5p	CLIP-seq
MIRT2447071	hsa-miR-3689a-3p	CLIP-seq
MIRT2447072	hsa-miR-3689c	CLIP-seq
MIRT2447073	hsa-miR-3918	CLIP-seq
MIRT2447074	hsa-miR-4728-5p	CLIP-seq

Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12595532, 28514442, 32296183, 32814053, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005783	Component	Endoplasmic reticulum	ISS
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS
GO:0005794	Component	Golgi apparatus	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005811	Component	Lipid droplet	IBA
GO:0005811	Component	Lipid droplet	IDA	35939579
GO:0005811	Component	Lipid droplet	IEA
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	IDA	12429024
GO:0006915	Process	Apoptotic process	IBA
GO:0006915	Process	Apoptotic process	IDA	12429024
GO:0006915	Process	Apoptotic process	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	TAS	10619428
GO:0016020	Component	Membrane	IEA
GO:0019915	Process	Lipid storage	IBA
GO:0019915	Process	Lipid storage	IEA
GO:0030127	Component	COPII vesicle coat	IEA
GO:0030127	Component	COPII vesicle coat	ISS
GO:0030137	Component	COPI-coated vesicle	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031667	Process	Response to nutrient levels	IEA
GO:0034379	Process	Very-low-density lipoprotein particle assembly	IEA
GO:0034379	Process	Very-low-density lipoprotein particle assembly	ISS
GO:0042802	Function	Identical protein binding	IPI	12595532, 32296183
GO:0043065	Process	Positive regulation of apoptotic process	IDA	12595532
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12595532
GO:0060090	Function	Molecular adaptor activity	IEA
GO:0060090	Function	Molecular adaptor activity	ISS
GO:0070300	Function	Phosphatidic acid binding	IEA
GO:0090110	Process	COPII-coated vesicle cargo loading	IEA
GO:0090110	Process	COPII-coated vesicle cargo loading	ISS
GO:0090207	Process	Regulation of triglyceride metabolic process	IEA
GO:0090207	Process	Regulation of triglyceride metabolic process	ISS
GO:0097194	Process	Execution phase of apoptosis	IEA
GO:0097194	Process	Execution phase of apoptosis	ISS	9564035
GO:0120009	Process	Intermembrane lipid transfer	IEA
GO:0120013	Function	Lipid transfer activity	IBA
GO:0120013	Function	Lipid transfer activity	IEA
GO:0120013	Function	Lipid transfer activity	ISS
GO:0160077	Process	Lipid droplet fusion	IBA
GO:0160077	Process	Lipid droplet fusion	IEA
GO:0160077	Process	Lipid droplet fusion	IMP	35939579

MIM	HGNC	e!Ensembl
604441	1977	ENSG00000136305

Q9UHD4

Protein name

Lipid transferase CIDEB (Cell death activator CIDE-B) (Cell death-inducing DFFA-like effector B)

Protein function

Lipid transferase specifically expressed in hepatocytes, which promotes unilocular lipid droplet formation by mediating lipid droplet fusion (PubMed:35939579). Lipid droplet fusion promotes their enlargement, restricting lipolysis and favoring l

PDB

1D4B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02017	CIDE-N	35 → 109	CIDE-N domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver and small intestine and, at lower levels, in colon, kidney and spleen. {ECO:0000269|PubMed:12429024}.

Sequence

MEYLSALNPSDLLRSVSNISSEFGRRVWTSAPPPQRPFRVCDHKRTIRKGLTAATRQELL
AKALETLLLNGVLTLVLEEDGTAVDSEDFFQLLEDDTCLMVLQSGQSWSPTRSGVLSYGL
GRERPKHSKDIARFTFDVYKQNPRDLFGSLNVKATFYGLYSMSCDFQGLGPKKVLRELLR
WTSTLLQGLGHMLLGISSTLRHAVEGAEQWQQKGRLHSY

Sequence length

219

Interactions

View interactions

	KEGG
	Cholesterol metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANORECTAL MALFORMATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23475172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26936111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26936111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	19661960	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	35475772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CIDEB (cell death inducing DFFA like effector b)