Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27129
Gene name	Heat shock protein family B (small) member 7
Gene symbol	HSPB7
Synonyms (NCBI Gene)	cvHSP
Chromosome	1
Chromosome location	1p36.13
Summary	This gene encodes a small heat shock family B member that can heterodimerize with similar heat shock proteins. Defects in this gene are associated with advanced heart failure. In addition, the encoded protein may be a tumor suppressor in the p53 pathway,

105

Show/Hide all (105)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022635	hsa-miR-124-3p	Microarray	18668037
MIRT027658	hsa-miR-98-5p	Microarray	19088304
MIRT029397	hsa-miR-26b-5p	Microarray	19088304
MIRT1056430	hsa-miR-1193	CLIP-seq
MIRT1056431	hsa-miR-1254	CLIP-seq
MIRT1056432	hsa-miR-1276	CLIP-seq
MIRT1056433	hsa-miR-214	CLIP-seq
MIRT1056434	hsa-miR-31	CLIP-seq
MIRT1056435	hsa-miR-3116	CLIP-seq
MIRT1056436	hsa-miR-3134	CLIP-seq
MIRT1056437	hsa-miR-3150a-5p	CLIP-seq
MIRT1056438	hsa-miR-3150b-5p	CLIP-seq
MIRT1056439	hsa-miR-320e	CLIP-seq
MIRT1056440	hsa-miR-3612	CLIP-seq
MIRT1056441	hsa-miR-3619-5p	CLIP-seq
MIRT1056442	hsa-miR-3679-3p	CLIP-seq
MIRT1056443	hsa-miR-3688-5p	CLIP-seq
MIRT1056444	hsa-miR-3689a-3p	CLIP-seq
MIRT1056445	hsa-miR-3689c	CLIP-seq
MIRT1056446	hsa-miR-4254	CLIP-seq
MIRT1056447	hsa-miR-4311	CLIP-seq
MIRT1056448	hsa-miR-4419a	CLIP-seq
MIRT1056449	hsa-miR-4434	CLIP-seq
MIRT1056450	hsa-miR-4443	CLIP-seq
MIRT1056451	hsa-miR-4510	CLIP-seq
MIRT1056452	hsa-miR-4516	CLIP-seq
MIRT1056453	hsa-miR-4525	CLIP-seq
MIRT1056454	hsa-miR-4530	CLIP-seq
MIRT1056455	hsa-miR-4648	CLIP-seq
MIRT1056456	hsa-miR-4654	CLIP-seq
MIRT1056457	hsa-miR-4690-5p	CLIP-seq
MIRT1056458	hsa-miR-4716-3p	CLIP-seq
MIRT1056459	hsa-miR-4728-5p	CLIP-seq
MIRT1056460	hsa-miR-4731-5p	CLIP-seq
MIRT1056461	hsa-miR-4769-5p	CLIP-seq
MIRT1056462	hsa-miR-542-5p	CLIP-seq
MIRT1056463	hsa-miR-583	CLIP-seq
MIRT1056464	hsa-miR-615-5p	CLIP-seq
MIRT1056465	hsa-miR-650	CLIP-seq
MIRT1056466	hsa-miR-661	CLIP-seq
MIRT1056467	hsa-miR-761	CLIP-seq
MIRT1549652	hsa-let-7a	CLIP-seq
MIRT1549653	hsa-let-7b	CLIP-seq
MIRT1549654	hsa-let-7c	CLIP-seq
MIRT1549655	hsa-let-7d	CLIP-seq
MIRT1549656	hsa-let-7e	CLIP-seq
MIRT1549657	hsa-let-7f	CLIP-seq
MIRT1549658	hsa-let-7g	CLIP-seq
MIRT1549659	hsa-let-7i	CLIP-seq
MIRT1549660	hsa-miR-103b	CLIP-seq
MIRT1549661	hsa-miR-1303	CLIP-seq
MIRT1549662	hsa-miR-148a	CLIP-seq
MIRT1549663	hsa-miR-148b	CLIP-seq
MIRT1549664	hsa-miR-152	CLIP-seq
MIRT1549665	hsa-miR-153	CLIP-seq
MIRT1549666	hsa-miR-219-1-3p	CLIP-seq
MIRT1549667	hsa-miR-3150a-3p	CLIP-seq
MIRT1549668	hsa-miR-3175	CLIP-seq
MIRT1549669	hsa-miR-3184	CLIP-seq
MIRT1549670	hsa-miR-330-3p	CLIP-seq
MIRT1549671	hsa-miR-3614-3p	CLIP-seq
MIRT1549672	hsa-miR-371b-3p	CLIP-seq
MIRT1549673	hsa-miR-3927	CLIP-seq
MIRT1549674	hsa-miR-423-5p	CLIP-seq
MIRT1549675	hsa-miR-4257	CLIP-seq
MIRT1549676	hsa-miR-4458	CLIP-seq
MIRT1549677	hsa-miR-448	CLIP-seq
MIRT1549678	hsa-miR-4500	CLIP-seq
MIRT1549679	hsa-miR-4650-3p	CLIP-seq
MIRT1056459	hsa-miR-4728-5p	CLIP-seq
MIRT1549680	hsa-miR-491-5p	CLIP-seq
MIRT1056462	hsa-miR-542-5p	CLIP-seq
MIRT1549681	hsa-miR-939	CLIP-seq
MIRT1549682	hsa-miR-98	CLIP-seq
MIRT1921639	hsa-miR-125a-5p	CLIP-seq
MIRT1921640	hsa-miR-125b	CLIP-seq
MIRT1921641	hsa-miR-3667-3p	CLIP-seq
MIRT1921642	hsa-miR-4319	CLIP-seq
MIRT1921643	hsa-miR-4732-3p	CLIP-seq
MIRT1921644	hsa-miR-4760-5p	CLIP-seq
MIRT1921645	hsa-miR-670	CLIP-seq
MIRT2012969	hsa-miR-4488	CLIP-seq
MIRT2012970	hsa-miR-4697-5p	CLIP-seq
MIRT1056442	hsa-miR-3679-3p	CLIP-seq
MIRT2245219	hsa-miR-4514	CLIP-seq
MIRT2245220	hsa-miR-4651	CLIP-seq
MIRT2245221	hsa-miR-4692	CLIP-seq
MIRT2245222	hsa-miR-4747-5p	CLIP-seq
MIRT2245223	hsa-miR-541	CLIP-seq
MIRT1056462	hsa-miR-542-5p	CLIP-seq
MIRT2245224	hsa-miR-596	CLIP-seq
MIRT2245225	hsa-miR-608	CLIP-seq
MIRT2245226	hsa-miR-654-5p	CLIP-seq
MIRT1549666	hsa-miR-219-1-3p	CLIP-seq
MIRT2389209	hsa-miR-3127-3p	CLIP-seq
MIRT1549667	hsa-miR-3150a-3p	CLIP-seq
MIRT1549668	hsa-miR-3175	CLIP-seq
MIRT1549672	hsa-miR-371b-3p	CLIP-seq
MIRT1549675	hsa-miR-4257	CLIP-seq
MIRT2389210	hsa-miR-4433	CLIP-seq
MIRT2012969	hsa-miR-4488	CLIP-seq
MIRT2012970	hsa-miR-4697-5p	CLIP-seq
MIRT2389211	hsa-miR-4722-5p	CLIP-seq
MIRT1549680	hsa-miR-491-5p	CLIP-seq
MIRT1549681	hsa-miR-939	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	14594798, 16189514, 25416956, 28514442, 32296183
GO:0005515	Function	Protein binding	TAS	10593960
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19464326
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19464326
GO:0005737	Component	Cytoplasm	IEA
GO:0006986	Process	Response to unfolded protein	TAS	10593960
GO:0007507	Process	Heart development	IEA
GO:0008016	Process	Regulation of heart contraction	TAS	10593960
GO:0015030	Component	Cajal body	IEA
GO:0015629	Component	Actin cytoskeleton	IEA
GO:0016235	Component	Aggresome	IDA
GO:0031005	Function	Filamin binding	IEA

MIM	HGNC	e!Ensembl
610692	5249	ENSG00000173641

Q9UBY9

Protein name

Heat shock protein beta-7 (HspB7) (Cardiovascular heat shock protein) (cvHsp)

PDB

8PA0 , 8RHA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00011	HSP20	74 → 170	Hsp20/alpha crystallin family	Family

Tissue specificity

TISSUE SPECIFICITY: Isoform 1 is highly expressed in adult and fetal heart, skeletal muscle, and at a much lower levels in adipose tissue and in aorta. Undetectable in other tissues. Isoform 2 and isoform 3 are poorly detected in heart.

Sequence

MSHRTSSTFRAERSFHSSSSSSSSSTSSSASRALPAQDPPMEKALSMFSDDFGSFMRPHS
EPLAFPARPGGAGNIKTLGDAYEFAVDVRDFSPEDIIVTTSNNHIEVRAEKLAADGTVMN
TFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEHVQQTFRTEIKI

Sequence length

170

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oromandibular-limb hypogenesis spectrum	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bone Diseases Metabolic	Bone disease	Pubtator	37170285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	20124441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24585183	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	38084139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	20038796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28827800, 29331499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	20975947, 21459883, 23570452, 28296976, 32916098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	GWASDB_DG	20975947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27441470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	20975947, 21459883, 23570452, 27441470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20038796, 20124441, 21248228, 27441470, 28827800, 28973020, 29078393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24585183		★★★★★ ★☆☆☆☆ Found in Text Mining only
familial dilated cardiomyopathy	Dilated cardiomyopathy	Pubtator	21459883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20038796, 20124441, 21248228, 28827800, 28973020, 29078393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	20038796, 20124441, 21248228, 22499703, 31554410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	20038796	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16835851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24585183, 29577611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28827800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24585183, 29577611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23975165, 30660137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	24585183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Central	Sleep Apnea	BEFREE	27441470		★★★★★ ★☆☆☆☆ Found in Text Mining only

HSPB7 (heat shock protein family B (small) member 7)