Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	27122
Gene name	Dickkopf Wnt signaling pathway inhibitor 3
Gene symbol	DKK3
Synonyms (NCBI Gene)	CRRLREICRIG
Chromosome	11
Chromosome location	11p15.3
Summary	This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is d

309

Show/Hide all (309)

miRTarBase ID	miRNA	Experiments	Reference
MIRT053048	hsa-miR-183-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23538390
MIRT438225	hsa-miR-92b-3p	Luciferase reporter assayWestern blot	24325785
MIRT438225	hsa-miR-92b-3p	Luciferase reporter assayWestern blot	24325785
MIRT438225	hsa-miR-92b-3p	Luciferase reporter assayWestern blot	24325785
MIRT438225	hsa-miR-92b-3p	Luciferase reporter assayWestern blot	24325785
MIRT721540	hsa-miR-590-3p	HITS-CLIP	19536157
MIRT721539	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT721538	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT721537	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT572552	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT721536	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT721535	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT721534	hsa-miR-4775	HITS-CLIP	19536157
MIRT721533	hsa-miR-4799-5p	HITS-CLIP	19536157
MIRT721532	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT721531	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT721530	hsa-miR-4690-5p	HITS-CLIP	19536157
MIRT721529	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT721528	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT721527	hsa-miR-761	HITS-CLIP	19536157
MIRT721526	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT721525	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT721524	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT721523	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT721522	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT721521	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT721520	hsa-miR-4287	HITS-CLIP	19536157
MIRT721519	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT721518	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721517	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT721516	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT572556	hsa-miR-548aa	PAR-CLIP	20371350
MIRT572555	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT572554	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT572553	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT572552	hsa-miR-942-5p	PAR-CLIP	20371350
MIRT572551	hsa-miR-2355-5p	PAR-CLIP	20371350
MIRT572550	hsa-miR-515-5p	PAR-CLIP	20371350
MIRT572549	hsa-miR-519e-5p	PAR-CLIP	20371350
MIRT572548	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT737440	hsa-miR-125b-5p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	27788486
MIRT737440	hsa-miR-125b-5p	ChIP-seqLuciferase reporter assayqRT-PCRWestern blot	27788486
MIRT572552	hsa-miR-942-5p	Luciferase reporter assayWestern blottingqRT-PCR	32772782
MIRT737055	hsa-miR-483-3p	Western blottingMicroarrayqRT-PCR	31763724
MIRT737440	hsa-miR-125b-5p	MicroarrayImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCRIn situ hybridization	31754403
MIRT735396	hsa-miR-25-3p	Luciferase reporter assayWestern blottingMicroarrayImmunoprecipitaion (IP)qRT-PCR	33723747
MIRT721540	hsa-miR-590-3p	HITS-CLIP	19536157
MIRT721539	hsa-miR-6819-3p	HITS-CLIP	19536157
MIRT721538	hsa-miR-6877-3p	HITS-CLIP	19536157
MIRT721537	hsa-miR-520f-5p	HITS-CLIP	19536157
MIRT572552	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT721536	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT721535	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT721534	hsa-miR-4775	HITS-CLIP	19536157
MIRT721533	hsa-miR-4799-5p	HITS-CLIP	19536157
MIRT721532	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT721531	hsa-miR-3120-3p	HITS-CLIP	19536157
MIRT721530	hsa-miR-4690-5p	HITS-CLIP	19536157
MIRT721529	hsa-miR-214-3p	HITS-CLIP	19536157
MIRT721528	hsa-miR-3619-5p	HITS-CLIP	19536157
MIRT721527	hsa-miR-761	HITS-CLIP	19536157
MIRT721526	hsa-miR-6887-3p	HITS-CLIP	19536157
MIRT721525	hsa-miR-6892-3p	HITS-CLIP	19536157
MIRT721524	hsa-miR-2276-5p	HITS-CLIP	19536157
MIRT721523	hsa-miR-5088-3p	HITS-CLIP	19536157
MIRT721522	hsa-miR-877-3p	HITS-CLIP	19536157
MIRT721521	hsa-miR-6734-3p	HITS-CLIP	19536157
MIRT721520	hsa-miR-4287	HITS-CLIP	19536157
MIRT721519	hsa-miR-4685-3p	HITS-CLIP	19536157
MIRT721518	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT721517	hsa-miR-4749-3p	HITS-CLIP	19536157
MIRT721516	hsa-miR-642a-5p	HITS-CLIP	19536157
MIRT572556	hsa-miR-548aa	PAR-CLIP	20371350
MIRT572555	hsa-miR-548ap-3p	PAR-CLIP	20371350
MIRT572554	hsa-miR-548t-3p	PAR-CLIP	20371350
MIRT572553	hsa-miR-6793-3p	PAR-CLIP	20371350
MIRT572552	hsa-miR-942-5p	PAR-CLIP	20371350
MIRT572551	hsa-miR-2355-5p	PAR-CLIP	20371350
MIRT572550	hsa-miR-515-5p	PAR-CLIP	20371350
MIRT572549	hsa-miR-519e-5p	PAR-CLIP	20371350
MIRT572548	hsa-miR-3679-3p	PAR-CLIP	20371350
MIRT755753	hsa-miR-1290	Luciferase reporter assayWestern blottingqRT-PCR	35975203
MIRT937692	hsa-miR-25	CLIP-seq
MIRT937693	hsa-miR-3185	CLIP-seq
MIRT937694	hsa-miR-32	CLIP-seq
MIRT937695	hsa-miR-363	CLIP-seq
MIRT937696	hsa-miR-367	CLIP-seq
MIRT937697	hsa-miR-3921	CLIP-seq
MIRT937698	hsa-miR-4251	CLIP-seq
MIRT937699	hsa-miR-4303	CLIP-seq
MIRT937700	hsa-miR-4327	CLIP-seq
MIRT937701	hsa-miR-4329	CLIP-seq
MIRT937702	hsa-miR-4511	CLIP-seq
MIRT937703	hsa-miR-4646-5p	CLIP-seq
MIRT937704	hsa-miR-4653-5p	CLIP-seq
MIRT937705	hsa-miR-4668-5p	CLIP-seq
MIRT937706	hsa-miR-4747-5p	CLIP-seq
MIRT937707	hsa-miR-593	CLIP-seq
MIRT937708	hsa-miR-92a	CLIP-seq
MIRT937709	hsa-miR-92b	CLIP-seq
MIRT937710	hsa-miR-2276	CLIP-seq
MIRT937711	hsa-miR-4772-3p	CLIP-seq
MIRT937697	hsa-miR-3921	CLIP-seq
MIRT937704	hsa-miR-4653-5p	CLIP-seq
MIRT2212835	hsa-miR-141	CLIP-seq
MIRT2212836	hsa-miR-200a	CLIP-seq
MIRT937692	hsa-miR-25	CLIP-seq
MIRT2212837	hsa-miR-3160-3p	CLIP-seq
MIRT937694	hsa-miR-32	CLIP-seq
MIRT2212838	hsa-miR-330-3p	CLIP-seq
MIRT937695	hsa-miR-363	CLIP-seq
MIRT937696	hsa-miR-367	CLIP-seq
MIRT2212839	hsa-miR-371-5p	CLIP-seq
MIRT937697	hsa-miR-3921	CLIP-seq
MIRT2212840	hsa-miR-450b-5p	CLIP-seq
MIRT937704	hsa-miR-4653-5p	CLIP-seq
MIRT2212841	hsa-miR-518a-5p	CLIP-seq
MIRT2212842	hsa-miR-527	CLIP-seq
MIRT937708	hsa-miR-92a	CLIP-seq
MIRT937709	hsa-miR-92b	CLIP-seq
MIRT2428235	hsa-miR-122	CLIP-seq
MIRT2428236	hsa-miR-1249	CLIP-seq
MIRT2428237	hsa-miR-1278	CLIP-seq
MIRT2428238	hsa-miR-3622a-3p	CLIP-seq
MIRT2428239	hsa-miR-3622b-3p	CLIP-seq
MIRT2428240	hsa-miR-374a	CLIP-seq
MIRT2428241	hsa-miR-374b	CLIP-seq
MIRT2428242	hsa-miR-4275	CLIP-seq
MIRT2212840	hsa-miR-450b-5p	CLIP-seq
MIRT2428243	hsa-miR-452	CLIP-seq
MIRT2428244	hsa-miR-4639-5p	CLIP-seq
MIRT2428245	hsa-miR-4676-3p	CLIP-seq
MIRT2428246	hsa-miR-4729	CLIP-seq
MIRT2428247	hsa-miR-4752	CLIP-seq
MIRT2428248	hsa-miR-500a	CLIP-seq
MIRT2428249	hsa-miR-507	CLIP-seq
MIRT2428250	hsa-miR-513a-3p	CLIP-seq
MIRT2212841	hsa-miR-518a-5p	CLIP-seq
MIRT2212842	hsa-miR-527	CLIP-seq
MIRT2428251	hsa-miR-557	CLIP-seq
MIRT2428252	hsa-miR-570	CLIP-seq
MIRT2428253	hsa-miR-579	CLIP-seq
MIRT2436840	hsa-let-7a	CLIP-seq
MIRT2436841	hsa-let-7b	CLIP-seq
MIRT2436842	hsa-let-7c	CLIP-seq
MIRT2436843	hsa-let-7d	CLIP-seq
MIRT2436844	hsa-let-7e	CLIP-seq
MIRT2436845	hsa-let-7f	CLIP-seq
MIRT2436846	hsa-let-7g	CLIP-seq
MIRT2436847	hsa-let-7i	CLIP-seq
MIRT2428235	hsa-miR-122	CLIP-seq
MIRT2212835	hsa-miR-141	CLIP-seq
MIRT2212836	hsa-miR-200a	CLIP-seq
MIRT2436848	hsa-miR-28-5p	CLIP-seq
MIRT2436849	hsa-miR-3139	CLIP-seq
MIRT2212837	hsa-miR-3160-3p	CLIP-seq
MIRT2212838	hsa-miR-330-3p	CLIP-seq
MIRT2428238	hsa-miR-3622a-3p	CLIP-seq
MIRT2428239	hsa-miR-3622b-3p	CLIP-seq
MIRT2212839	hsa-miR-371-5p	CLIP-seq
MIRT937697	hsa-miR-3921	CLIP-seq
MIRT2436850	hsa-miR-4257	CLIP-seq
MIRT2436851	hsa-miR-4279	CLIP-seq
MIRT937699	hsa-miR-4303	CLIP-seq
MIRT937700	hsa-miR-4327	CLIP-seq
MIRT2436852	hsa-miR-4419a	CLIP-seq
MIRT2436853	hsa-miR-4458	CLIP-seq
MIRT2436854	hsa-miR-4500	CLIP-seq
MIRT2212840	hsa-miR-450b-5p	CLIP-seq
MIRT2436855	hsa-miR-4510	CLIP-seq
MIRT2436856	hsa-miR-4640-3p	CLIP-seq
MIRT937704	hsa-miR-4653-5p	CLIP-seq
MIRT2436857	hsa-miR-4663	CLIP-seq
MIRT2436858	hsa-miR-4738-3p	CLIP-seq
MIRT2428247	hsa-miR-4752	CLIP-seq
MIRT2212841	hsa-miR-518a-5p	CLIP-seq
MIRT2212842	hsa-miR-527	CLIP-seq
MIRT2428252	hsa-miR-570	CLIP-seq
MIRT2428253	hsa-miR-579	CLIP-seq
MIRT2436859	hsa-miR-587	CLIP-seq
MIRT937707	hsa-miR-593	CLIP-seq
MIRT2436860	hsa-miR-646	CLIP-seq
MIRT2436861	hsa-miR-708	CLIP-seq
MIRT2436862	hsa-miR-942	CLIP-seq
MIRT2436863	hsa-miR-98	CLIP-seq
MIRT2516679	hsa-miR-105	CLIP-seq
MIRT2428235	hsa-miR-122	CLIP-seq
MIRT2516680	hsa-miR-1254	CLIP-seq
MIRT2516681	hsa-miR-1273g	CLIP-seq
MIRT2516682	hsa-miR-1275	CLIP-seq
MIRT2516683	hsa-miR-138	CLIP-seq
MIRT2516684	hsa-miR-150	CLIP-seq
MIRT2516685	hsa-miR-185	CLIP-seq
MIRT2516686	hsa-miR-29a	CLIP-seq
MIRT2516687	hsa-miR-29b	CLIP-seq
MIRT2516688	hsa-miR-29c	CLIP-seq
MIRT2516689	hsa-miR-3116	CLIP-seq
MIRT2516690	hsa-miR-3151	CLIP-seq
MIRT2212837	hsa-miR-3160-3p	CLIP-seq
MIRT2516691	hsa-miR-3161	CLIP-seq
MIRT2516692	hsa-miR-3173-5p	CLIP-seq
MIRT2516693	hsa-miR-3611	CLIP-seq
MIRT2428238	hsa-miR-3622a-3p	CLIP-seq
MIRT2428239	hsa-miR-3622b-3p	CLIP-seq
MIRT2516694	hsa-miR-3650	CLIP-seq
MIRT2516695	hsa-miR-3681	CLIP-seq
MIRT2516696	hsa-miR-377	CLIP-seq
MIRT2516697	hsa-miR-423-3p	CLIP-seq
MIRT2516698	hsa-miR-4254	CLIP-seq
MIRT2516699	hsa-miR-4255	CLIP-seq
MIRT2516700	hsa-miR-4276	CLIP-seq
MIRT2516701	hsa-miR-4300	CLIP-seq
MIRT2516702	hsa-miR-4302	CLIP-seq
MIRT2516703	hsa-miR-4306	CLIP-seq
MIRT2516704	hsa-miR-4434	CLIP-seq
MIRT2516705	hsa-miR-4447	CLIP-seq
MIRT2516706	hsa-miR-4472	CLIP-seq
MIRT2516707	hsa-miR-4494	CLIP-seq
MIRT2516708	hsa-miR-4516	CLIP-seq
MIRT2516709	hsa-miR-4522	CLIP-seq
MIRT2516710	hsa-miR-4525	CLIP-seq
MIRT2516711	hsa-miR-4531	CLIP-seq
MIRT2516712	hsa-miR-4644	CLIP-seq
MIRT2516713	hsa-miR-4665-5p	CLIP-seq
MIRT2516714	hsa-miR-4713-5p	CLIP-seq
MIRT2516715	hsa-miR-4716-5p	CLIP-seq
MIRT2516716	hsa-miR-4723-5p	CLIP-seq
MIRT2428247	hsa-miR-4752	CLIP-seq
MIRT2516717	hsa-miR-4773	CLIP-seq
MIRT2516718	hsa-miR-4786-3p	CLIP-seq
MIRT2516719	hsa-miR-491-5p	CLIP-seq
MIRT2516720	hsa-miR-511	CLIP-seq
MIRT2516721	hsa-miR-532-3p	CLIP-seq
MIRT2516722	hsa-miR-563	CLIP-seq
MIRT2428252	hsa-miR-570	CLIP-seq
MIRT2428253	hsa-miR-579	CLIP-seq
MIRT2516723	hsa-miR-625	CLIP-seq
MIRT2516724	hsa-miR-626	CLIP-seq
MIRT2516725	hsa-miR-637	CLIP-seq
MIRT2516726	hsa-miR-661	CLIP-seq
MIRT2516727	hsa-miR-920	CLIP-seq
MIRT2516728	hsa-miR-939	CLIP-seq
MIRT2516679	hsa-miR-105	CLIP-seq
MIRT2428235	hsa-miR-122	CLIP-seq
MIRT2516680	hsa-miR-1254	CLIP-seq
MIRT2516681	hsa-miR-1273g	CLIP-seq
MIRT2516682	hsa-miR-1275	CLIP-seq
MIRT2516683	hsa-miR-138	CLIP-seq
MIRT2516684	hsa-miR-150	CLIP-seq
MIRT2516685	hsa-miR-185	CLIP-seq
MIRT2516686	hsa-miR-29a	CLIP-seq
MIRT2516687	hsa-miR-29b	CLIP-seq
MIRT2516688	hsa-miR-29c	CLIP-seq
MIRT2516689	hsa-miR-3116	CLIP-seq
MIRT2516690	hsa-miR-3151	CLIP-seq
MIRT2212837	hsa-miR-3160-3p	CLIP-seq
MIRT2516691	hsa-miR-3161	CLIP-seq
MIRT2516692	hsa-miR-3173-5p	CLIP-seq
MIRT937693	hsa-miR-3185	CLIP-seq
MIRT2516693	hsa-miR-3611	CLIP-seq
MIRT2428238	hsa-miR-3622a-3p	CLIP-seq
MIRT2428239	hsa-miR-3622b-3p	CLIP-seq
MIRT2516694	hsa-miR-3650	CLIP-seq
MIRT2516695	hsa-miR-3681	CLIP-seq
MIRT2516696	hsa-miR-377	CLIP-seq
MIRT2516697	hsa-miR-423-3p	CLIP-seq
MIRT2516698	hsa-miR-4254	CLIP-seq
MIRT2516699	hsa-miR-4255	CLIP-seq
MIRT2516700	hsa-miR-4276	CLIP-seq
MIRT2516701	hsa-miR-4300	CLIP-seq
MIRT2516702	hsa-miR-4302	CLIP-seq
MIRT2516703	hsa-miR-4306	CLIP-seq
MIRT2516704	hsa-miR-4434	CLIP-seq
MIRT2516705	hsa-miR-4447	CLIP-seq
MIRT2516706	hsa-miR-4472	CLIP-seq
MIRT2679289	hsa-miR-4476	CLIP-seq
MIRT2516707	hsa-miR-4494	CLIP-seq
MIRT2212840	hsa-miR-450b-5p	CLIP-seq
MIRT2516708	hsa-miR-4516	CLIP-seq
MIRT2516709	hsa-miR-4522	CLIP-seq
MIRT2516710	hsa-miR-4525	CLIP-seq
MIRT2516711	hsa-miR-4531	CLIP-seq
MIRT2428244	hsa-miR-4639-5p	CLIP-seq
MIRT2516712	hsa-miR-4644	CLIP-seq
MIRT937703	hsa-miR-4646-5p	CLIP-seq
MIRT2516713	hsa-miR-4665-5p	CLIP-seq
MIRT2516714	hsa-miR-4713-5p	CLIP-seq
MIRT2516715	hsa-miR-4716-5p	CLIP-seq
MIRT2516716	hsa-miR-4723-5p	CLIP-seq
MIRT937706	hsa-miR-4747-5p	CLIP-seq
MIRT2428247	hsa-miR-4752	CLIP-seq
MIRT2516717	hsa-miR-4773	CLIP-seq
MIRT2516718	hsa-miR-4786-3p	CLIP-seq
MIRT2516719	hsa-miR-491-5p	CLIP-seq
MIRT2428249	hsa-miR-507	CLIP-seq
MIRT2516720	hsa-miR-511	CLIP-seq
MIRT2212841	hsa-miR-518a-5p	CLIP-seq
MIRT2212842	hsa-miR-527	CLIP-seq
MIRT2516721	hsa-miR-532-3p	CLIP-seq
MIRT2428251	hsa-miR-557	CLIP-seq
MIRT2516722	hsa-miR-563	CLIP-seq
MIRT2428252	hsa-miR-570	CLIP-seq
MIRT2428253	hsa-miR-579	CLIP-seq
MIRT2516723	hsa-miR-625	CLIP-seq
MIRT2516724	hsa-miR-626	CLIP-seq
MIRT2516725	hsa-miR-637	CLIP-seq
MIRT2516726	hsa-miR-661	CLIP-seq
MIRT2516727	hsa-miR-920	CLIP-seq
MIRT2516728	hsa-miR-939	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
MYCN	Repression	18059033;21796614

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183, 32814053
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	TAS	10570958
GO:0009653	Process	Anatomical structure morphogenesis	TAS	10570958
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	NAS	24431302
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030325	Process	Adrenal gland development	IEP	12844346
GO:0032348	Process	Negative regulation of aldosterone biosynthetic process	IDA	16981135
GO:0039706	Function	Co-receptor binding	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	16981135
GO:0048019	Function	Receptor antagonist activity	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IBA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	12857724
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	23538390
GO:1902613	Process	Negative regulation of anti-Mullerian hormone signaling pathway	TAS	24449494
GO:2000065	Process	Negative regulation of cortisol biosynthetic process	IDA	16981135

MIM	HGNC	e!Ensembl
605416	2893	ENSG00000050165

Q9UBP4

Protein name

Dickkopf-related protein 3 (Dickkopf-3) (Dkk-3) (hDkk-3)

Protein function

Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development,

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04706	Dickkopf_N	146 → 196	Dickkopf N-terminal cysteine-rich region	Family

Tissue specificity

TISSUE SPECIFICITY: Highest expression in heart, brain, and spinal cord. {ECO:0000269|PubMed:10570958, ECO:0000269|Ref.4}.

Sequence

MQRLGATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMED
TQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITN
NQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTR
DSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGEL
CHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILL
PREVPDEYEVGSFMEEVRQELEDLERSLTEEMALREPAAAAAALLGGEEI

Sequence length

350

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Autosomal dominant polycystic liver disease	Likely pathogenic	rs2134978784, rs201778105	RCV001844920 RCV001844921	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Autosomal dominant polycystic kidney disease	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC KIDNEY, AUTOSOMAL DOMINANT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC LIVER DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (204)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	28440495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	15226763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11408931, 17947472, 19493271, 22473694, 23354949, 26093488, 29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26093488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20514419, 31682048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22473694, 24350795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	22473694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	29391809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28249601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	28249601	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	22253443, 23567267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28249601, 29630043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	28249601	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19457090	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26119087, 35962130	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28249601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	26091808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	24330574		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	30355799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28249601, 29630043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28219919, 28674110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	9070656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28219919, 28674110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32809235, 34798808	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25672757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18247400, 23765731, 29858602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16609023, 22665039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	16609023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast cancer, lobular	Breast Cancer	BEFREE	29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18654608, 18826564, 19570204, 19859801, 22274868, 23320751, 23890219, 27467270, 29843219		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	18826564, 27467270	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19570204, 23320751, 23516639, 23890219, 29843219, 30154364, 33462997, 36869893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brooke-Spiegler syndrome	Brooke-Spiegler Syndrome	BEFREE	28118819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	23154266, 25484078, 28249601, 29843219, 34124998	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20532910, 22473694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26397159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	19496188, 25344678, 27014972, 32577022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	23154266	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22665039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25760729, 26457595, 27640551, 28011506, 29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25679997	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23154266	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29843219	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20532910, 23528302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	28674110		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22961207, 28810582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22961207, 28810582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22253443, 23567267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	29568962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	28685176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18765431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	24309205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19496188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19051296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	15858124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19051296, 22473694, 31485167, 31763724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18219095	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	19051296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19051296, 22529687, 29476593, 29869456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29568962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	14767340, 17145819, 19562778, 21268126, 24676838, 25679997, 29552228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28219919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28219919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28219919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26687825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33682459	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22555103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	32805208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32805208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	20532910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	28599252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28385379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	29843219	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22171134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26715268, 31737564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	26715268, 33670899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	LHGDN	18059033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21275459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	18443132, 35599254, 37149563, 37434432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23376635, 25301448, 9070656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18363832, 18759060, 23376635, 25301448, 9070656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18443132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18443132, 31933377, 37149563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25598421, 25908389, 26388612, 26535026, 27733185, 27763568, 27801851, 29438779, 29949160, 30503496, 30556881, 30962271, 30997639, 31171769, 31258712, 31799670, 9070656 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
granulosa cell tumor	Granulosa Cell Tumor	BEFREE	27431680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32809235	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32809235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	25344678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	28969056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	19437037, 27788486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18826564, 23890219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	33683746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30279273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	35796776	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20616171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27010856, 29726981, 31202596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30180910, 31202596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	20795789, 28440495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	26091808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20811686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19437037, 19496188, 22351518, 25344678, 28168749, 31663777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19496188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19437037, 31663777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11814687, 18048388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29843219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	25672757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	34565005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25394252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	18922905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18654608, 18826564, 19570204, 19859801, 22274868, 23320751, 23890219, 27467270, 29391809, 29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22555103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26715268, 31737564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21268126, 29098038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31663777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25760729, 26457595, 27640551, 28011506, 28470144, 29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20811686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20532910, 23528302, 29843219, 30631061		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21879258, 21987623, 24372695, 26395974, 27468808, 31663777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16266978, 18247400, 18727918, 22941469, 23538390, 23765731, 24498395, 26503968, 26689513, 27767086, 29843383, 29858602, 30779066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19051296, 28643146, 31423109, 31561329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	17273781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	23702469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22665039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15226763, 18727918, 19493271, 20532910, 20811686, 21982838, 21987623, 22274868, 23354949, 23702469, 25823913, 26503968, 26836118, 27866302, 27959428 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	17273781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22961207, 28810582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19051296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18654608, 18826564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23890219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22253443, 23567267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	23567267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	16568085, 31844121		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16568085, 18033687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25484078	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28978116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	35562749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	27349317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27349317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25679997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	24309205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31025872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34485531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11408931, 11708809, 11814687, 14767340, 15226763, 15516983, 16568085, 17409975, 17947472, 18247400, 18363832, 18654608, 18727918, 18826564, 18922905 View all (52 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21572098, 21796614		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30258353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	26091808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	31025872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	11408931, 11708809, 17947472, 24498395, 25760729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	17273781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	27349317	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	27959428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	26687825	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	35137918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	15087387		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29250147, 30926679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	29843219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	20532910, 23528302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27806724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	18727918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21879258, 21987623, 24372695, 26395974, 27468808, 31663777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	30355799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21879258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16036106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21987623	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23702469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	20616171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	20616171		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia Vera	Polycythemia Vera	BEFREE	24309205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16266978, 18247400, 18727918, 22941469, 23538390, 23765731, 24498395, 26503968, 26689513, 27767086, 29843383, 29858602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	29858602	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15899813, 20976069, 23538390, 26503968, 26621187, 26658102, 26689513, 27767086, 30779066, 31115550, 31819067, 35303365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16751809		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22071168	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29858602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	29858602	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	21268126, 29098038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17145819, 19562778, 21268126, 25679997, 29552228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29726981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	31202596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	22491018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15998302		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15998302		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15998302	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBASTIAN SYNDROME	SEBASTIAN SYNDROME	BEFREE	28118819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11408931, 21932035, 28470144, 29843219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	19192722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22171134, 30181180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27349317, 33281184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19192722, 28470144, 30569110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19051296, 22421143, 31423109, 31561329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	19051296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19051296, 31561329, 34124998, 34565005	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29843219	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	24309205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	23702469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23702469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	30246484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	19122685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27827955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22961207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29284609		★★★★★ ★☆☆☆☆ Found in Text Mining only

DKK3 (dickkopf Wnt signaling pathway inhibitor 3)