Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27113
Gene name	BCL2 binding component 3
Gene symbol	BBC3
Synonyms (NCBI Gene)	JFY-1JFY1PUMA
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It

501

Show/Hide all (501)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004500	hsa-miR-483-3p	qRT-PCRLuciferase reporter assayWestern blotNorthern blot	20388800
MIRT003367	hsa-miR-221-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	20813046
MIRT005369	hsa-miR-222-3p	ImmunohistochemistryIn situ hybridizationLuciferase reporter assayNorthern blotWestern blot	20813046
MIRT005915	hsa-miR-125b-5p	Luciferase reporter assayqRT-PCRWestern blot	20886540
MIRT006683	hsa-miR-296-5p	Luciferase reporter assayqRT-PCRWestern blot	21633093
MIRT003367	hsa-miR-221-3p	Luciferase reporter assay	21042732
MIRT005369	hsa-miR-222-3p	Luciferase reporter assay	21042732
MIRT016253	hsa-miR-504-5p	qRT-PCR	20542001
MIRT003367	hsa-miR-221-3p	Reporter assay;Microarray	20018759
MIRT003367	hsa-miR-221-3p	Luciferase reporter assayqRT-PCRWestern blot	22075712
MIRT003367	hsa-miR-221-3p	qRT-PCRWestern blotReporter assay	22075712
MIRT005369	hsa-miR-222-3p	qRT-PCRWestern blotReporter assay	22075712
MIRT438653	hsa-miR-149-5p	ImmunofluorescenceLuciferase reporter assayNorthern blotqRT-PCRWestern blot	23873935
MIRT438653	hsa-miR-149-5p	ImmunofluorescenceLuciferase reporter assayNorthern blotqRT-PCRWestern blot	23873935
MIRT005369	hsa-miR-222-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	24452416
MIRT438653	hsa-miR-149-5p	ImmunofluorescenceLuciferase reporter assayNorthern blotqRT-PCRWestern blot	23873935
MIRT438653	hsa-miR-149-5p	ImmunofluorescenceLuciferase reporter assayNorthern blotqRT-PCRWestern blot	23873935
MIRT005369	hsa-miR-222-3p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	24452416
MIRT481013	hsa-miR-6088	PAR-CLIP	24398324
MIRT481012	hsa-miR-143-3p	PAR-CLIP	24398324
MIRT481010	hsa-miR-4770	PAR-CLIP	24398324
MIRT481011	hsa-miR-4324	PAR-CLIP	24398324
MIRT480971	hsa-miR-544b	PAR-CLIP	24398324
MIRT481009	hsa-miR-3124-3p	PAR-CLIP	24398324
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	24398324
MIRT481007	hsa-miR-1273f	PAR-CLIP	24398324
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	24398324
MIRT481003	hsa-miR-541-3p	PAR-CLIP	24398324
MIRT481002	hsa-miR-654-5p	PAR-CLIP	24398324
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	24398324
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	24398324
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	24398324
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	24398324
MIRT480997	hsa-miR-876-3p	PAR-CLIP	24398324
MIRT480996	hsa-miR-378a-5p	PAR-CLIP	24398324
MIRT480995	hsa-miR-1200	PAR-CLIP	24398324
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	24398324
MIRT480993	hsa-miR-3074-5p	PAR-CLIP	24398324
MIRT480992	hsa-miR-7152-5p	PAR-CLIP	24398324
MIRT480990	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT480988	hsa-miR-759	PAR-CLIP	23592263
MIRT480987	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT480986	hsa-miR-3663-3p	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480982	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT480981	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT005614	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT480980	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT480979	hsa-miR-4779	PAR-CLIP	23592263
MIRT480978	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT480977	hsa-miR-4459	PAR-CLIP	23592263
MIRT480976	hsa-miR-665	PAR-CLIP	23592263
MIRT480975	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT480974	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT480973	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT480972	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT480971	hsa-miR-544b	PAR-CLIP	23592263
MIRT480969	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT480970	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT480968	hsa-miR-6089	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480966	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT480965	hsa-miR-765	PAR-CLIP	23592263
MIRT480963	hsa-miR-4271	PAR-CLIP	23592263
MIRT480962	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT480961	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT480960	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT480959	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT480958	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT481013	hsa-miR-6088	PAR-CLIP	23592263
MIRT481012	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT481010	hsa-miR-4770	PAR-CLIP	23592263
MIRT481011	hsa-miR-4324	PAR-CLIP	23592263
MIRT480971	hsa-miR-544b	PAR-CLIP	23592263
MIRT481009	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT481007	hsa-miR-1273f	PAR-CLIP	23592263
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT481003	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT481002	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT480997	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT480996	hsa-miR-378a-5p	PAR-CLIP	23592263
MIRT480995	hsa-miR-1200	PAR-CLIP	23592263
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT480993	hsa-miR-3074-5p	PAR-CLIP	23592263
MIRT480992	hsa-miR-7152-5p	PAR-CLIP	23592263
MIRT481013	hsa-miR-6088	PAR-CLIP	23592263
MIRT481012	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT481010	hsa-miR-4770	PAR-CLIP	23592263
MIRT481011	hsa-miR-4324	PAR-CLIP	23592263
MIRT481009	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT481007	hsa-miR-1273f	PAR-CLIP	23592263
MIRT481006	hsa-miR-6087	PAR-CLIP	23592263
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT481004	hsa-miR-4767	PAR-CLIP	23592263
MIRT481003	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT481002	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT480997	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT480996	hsa-miR-378a-5p	PAR-CLIP	23592263
MIRT480995	hsa-miR-1200	PAR-CLIP	23592263
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT480993	hsa-miR-3074-5p	PAR-CLIP	23592263
MIRT480992	hsa-miR-7152-5p	PAR-CLIP	23592263
MIRT480991	hsa-miR-4523	PAR-CLIP	23592263
MIRT480990	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT480989	hsa-miR-3943	PAR-CLIP	23592263
MIRT480988	hsa-miR-759	PAR-CLIP	23592263
MIRT480987	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT480986	hsa-miR-3663-3p	PAR-CLIP	23592263
MIRT480985	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT480984	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT480983	hsa-miR-4784	PAR-CLIP	23592263
MIRT480970	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT480968	hsa-miR-6089	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480982	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT480981	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT005614	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT480980	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT480979	hsa-miR-4779	PAR-CLIP	23592263
MIRT480978	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT480977	hsa-miR-4459	PAR-CLIP	23592263
MIRT480976	hsa-miR-665	PAR-CLIP	23592263
MIRT480975	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT480974	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT480973	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT480972	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT480971	hsa-miR-544b	PAR-CLIP	23592263
MIRT480969	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT480970	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT480968	hsa-miR-6089	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480966	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT480965	hsa-miR-765	PAR-CLIP	23592263
MIRT480964	hsa-miR-2861	PAR-CLIP	23592263
MIRT480963	hsa-miR-4271	PAR-CLIP	23592263
MIRT480962	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT480961	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT480960	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT480959	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT480958	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT004500	hsa-miR-483-3p	MicroarrayqRT-PCRWestern blot	27120784
MIRT003367	hsa-miR-221-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRAGO2 binding RNA immunoprecipitation qRT-PCR	26249174
MIRT003367	hsa-miR-221-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRAGO2 binding RNA immunoprecipitation qRT-PCR	26249174
MIRT005369	hsa-miR-222-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRAGO2 binding RNA immunoprecipitation qRT-PCR	26249174
MIRT005369	hsa-miR-222-3p	ImmunoblotIn situ hybridizationLuciferase reporter assayMicroarrayqRT-PCRAGO2 binding RNA immunoprecipitation qRT-PCR	26249174
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	26701625
MIRT481007	hsa-miR-1273f	PAR-CLIP	26701625
MIRT481007	hsa-miR-1273f	PAR-CLIP	26701625
MIRT481012	hsa-miR-143-3p	PAR-CLIP	26701625
MIRT481012	hsa-miR-143-3p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	26701625
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	26701625
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481004	hsa-miR-4767	PAR-CLIP	26701625
MIRT481010	hsa-miR-4770	PAR-CLIP	26701625
MIRT481010	hsa-miR-4770	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481003	hsa-miR-541-3p	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481006	hsa-miR-6087	PAR-CLIP	26701625
MIRT481013	hsa-miR-6088	PAR-CLIP	26701625
MIRT481013	hsa-miR-6088	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481002	hsa-miR-654-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT480997	hsa-miR-876-3p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT003367	hsa-miR-221-3p	qRT-PCR	33336275
MIRT004500	hsa-miR-483-3p	Luciferase reporter assayWestern blottingNorthern blottingqRT-PCRin vivo gain/loss-of-function experiments	20388800
MIRT004500	hsa-miR-483-3p	Luciferase reporter assayWestern blottingMicroarrayin vitro cullelar assaysqRT-PCR	21859927
MIRT481013	hsa-miR-6088	PAR-CLIP	24398324
MIRT481012	hsa-miR-143-3p	PAR-CLIP	24398324
MIRT481010	hsa-miR-4770	PAR-CLIP	24398324
MIRT481011	hsa-miR-4324	PAR-CLIP	24398324
MIRT480971	hsa-miR-544b	PAR-CLIP	24398324
MIRT481009	hsa-miR-3124-3p	PAR-CLIP	24398324
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	24398324
MIRT481007	hsa-miR-1273f	PAR-CLIP	24398324
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	24398324
MIRT481003	hsa-miR-541-3p	PAR-CLIP	24398324
MIRT481002	hsa-miR-654-5p	PAR-CLIP	24398324
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	24398324
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	24398324
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	24398324
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	24398324
MIRT480997	hsa-miR-876-3p	PAR-CLIP	24398324
MIRT480996	hsa-miR-378a-5p	PAR-CLIP	24398324
MIRT480995	hsa-miR-1200	PAR-CLIP	24398324
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	24398324
MIRT480993	hsa-miR-3074-5p	PAR-CLIP	24398324
MIRT480992	hsa-miR-7152-5p	PAR-CLIP	24398324
MIRT480990	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT480988	hsa-miR-759	PAR-CLIP	23592263
MIRT480987	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT480986	hsa-miR-3663-3p	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480982	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT480981	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT005614	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT480980	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT480979	hsa-miR-4779	PAR-CLIP	23592263
MIRT480978	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT480977	hsa-miR-4459	PAR-CLIP	23592263
MIRT480976	hsa-miR-665	PAR-CLIP	23592263
MIRT480975	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT480974	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT480973	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT480972	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT480971	hsa-miR-544b	PAR-CLIP	23592263
MIRT480969	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT480970	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT480968	hsa-miR-6089	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480966	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT480965	hsa-miR-765	PAR-CLIP	23592263
MIRT480963	hsa-miR-4271	PAR-CLIP	23592263
MIRT480962	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT480961	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT480960	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT480959	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT480958	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT481013	hsa-miR-6088	PAR-CLIP	23592263
MIRT481012	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT481010	hsa-miR-4770	PAR-CLIP	23592263
MIRT481011	hsa-miR-4324	PAR-CLIP	23592263
MIRT480971	hsa-miR-544b	PAR-CLIP	23592263
MIRT481009	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT481007	hsa-miR-1273f	PAR-CLIP	23592263
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT481003	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT481002	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT480997	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT480996	hsa-miR-378a-5p	PAR-CLIP	23592263
MIRT480995	hsa-miR-1200	PAR-CLIP	23592263
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT480993	hsa-miR-3074-5p	PAR-CLIP	23592263
MIRT480992	hsa-miR-7152-5p	PAR-CLIP	23592263
MIRT481013	hsa-miR-6088	PAR-CLIP	23592263
MIRT481012	hsa-miR-143-3p	PAR-CLIP	23592263
MIRT481010	hsa-miR-4770	PAR-CLIP	23592263
MIRT481011	hsa-miR-4324	PAR-CLIP	23592263
MIRT481009	hsa-miR-3124-3p	PAR-CLIP	23592263
MIRT481008	hsa-miR-4708-5p	PAR-CLIP	23592263
MIRT481007	hsa-miR-1273f	PAR-CLIP	23592263
MIRT481006	hsa-miR-6087	PAR-CLIP	23592263
MIRT481005	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT481004	hsa-miR-4767	PAR-CLIP	23592263
MIRT481003	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT481002	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT481001	hsa-miR-92a-2-5p	PAR-CLIP	23592263
MIRT481000	hsa-miR-6769a-5p	PAR-CLIP	23592263
MIRT480999	hsa-miR-6769b-5p	PAR-CLIP	23592263
MIRT480998	hsa-miR-323a-5p	PAR-CLIP	23592263
MIRT480997	hsa-miR-876-3p	PAR-CLIP	23592263
MIRT480996	hsa-miR-378a-5p	PAR-CLIP	23592263
MIRT480995	hsa-miR-1200	PAR-CLIP	23592263
MIRT480994	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT480993	hsa-miR-3074-5p	PAR-CLIP	23592263
MIRT480992	hsa-miR-7152-5p	PAR-CLIP	23592263
MIRT480991	hsa-miR-4523	PAR-CLIP	23592263
MIRT480990	hsa-miR-5586-3p	PAR-CLIP	23592263
MIRT480989	hsa-miR-3943	PAR-CLIP	23592263
MIRT480988	hsa-miR-759	PAR-CLIP	23592263
MIRT480987	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT480986	hsa-miR-3663-3p	PAR-CLIP	23592263
MIRT480985	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT480984	hsa-miR-3150b-3p	PAR-CLIP	23592263
MIRT480983	hsa-miR-4784	PAR-CLIP	23592263
MIRT480970	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT480968	hsa-miR-6089	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480982	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT480981	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT005614	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT480980	hsa-miR-6753-5p	PAR-CLIP	23592263
MIRT480979	hsa-miR-4779	PAR-CLIP	23592263
MIRT480978	hsa-miR-4733-3p	PAR-CLIP	23592263
MIRT480977	hsa-miR-4459	PAR-CLIP	23592263
MIRT480976	hsa-miR-665	PAR-CLIP	23592263
MIRT480975	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT480974	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT480973	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT480972	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT480971	hsa-miR-544b	PAR-CLIP	23592263
MIRT480969	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT480970	hsa-miR-5008-5p	PAR-CLIP	23592263
MIRT480968	hsa-miR-6089	PAR-CLIP	23592263
MIRT480967	hsa-miR-4755-3p	PAR-CLIP	23592263
MIRT480966	hsa-miR-6828-5p	PAR-CLIP	23592263
MIRT480965	hsa-miR-765	PAR-CLIP	23592263
MIRT480964	hsa-miR-2861	PAR-CLIP	23592263
MIRT480963	hsa-miR-4271	PAR-CLIP	23592263
MIRT480962	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT480961	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT480960	hsa-miR-625-5p	PAR-CLIP	23592263
MIRT480959	hsa-miR-6795-5p	PAR-CLIP	23592263
MIRT480958	hsa-miR-6887-5p	PAR-CLIP	23592263
MIRT816632	hsa-miR-101	CLIP-seq
MIRT816633	hsa-miR-1184	CLIP-seq
MIRT816634	hsa-miR-1207-3p	CLIP-seq
MIRT816635	hsa-miR-122	CLIP-seq
MIRT816636	hsa-miR-1226	CLIP-seq
MIRT816637	hsa-miR-1289	CLIP-seq
MIRT816638	hsa-miR-1298	CLIP-seq
MIRT816639	hsa-miR-1301	CLIP-seq
MIRT816640	hsa-miR-139-5p	CLIP-seq
MIRT816641	hsa-miR-144	CLIP-seq
MIRT816642	hsa-miR-148a	CLIP-seq
MIRT816643	hsa-miR-148b	CLIP-seq
MIRT816644	hsa-miR-152	CLIP-seq
MIRT816645	hsa-miR-1587	CLIP-seq
MIRT816646	hsa-miR-1910	CLIP-seq
MIRT816647	hsa-miR-199a-5p	CLIP-seq
MIRT816648	hsa-miR-199b-5p	CLIP-seq
MIRT816649	hsa-miR-24	CLIP-seq
MIRT816650	hsa-miR-3120-3p	CLIP-seq
MIRT816651	hsa-miR-3135b	CLIP-seq
MIRT816652	hsa-miR-3605-3p	CLIP-seq
MIRT816653	hsa-miR-3652	CLIP-seq
MIRT816654	hsa-miR-378g	CLIP-seq
MIRT816655	hsa-miR-4283	CLIP-seq
MIRT816656	hsa-miR-4430	CLIP-seq
MIRT816657	hsa-miR-4433	CLIP-seq
MIRT816658	hsa-miR-4438	CLIP-seq
MIRT816659	hsa-miR-4489	CLIP-seq
MIRT816660	hsa-miR-4492	CLIP-seq
MIRT816661	hsa-miR-4498	CLIP-seq
MIRT816662	hsa-miR-4505	CLIP-seq
MIRT816663	hsa-miR-4656	CLIP-seq
MIRT816664	hsa-miR-4660	CLIP-seq
MIRT816665	hsa-miR-4663	CLIP-seq
MIRT816666	hsa-miR-4664-3p	CLIP-seq
MIRT816667	hsa-miR-4675	CLIP-seq
MIRT816668	hsa-miR-4697-3p	CLIP-seq
MIRT816669	hsa-miR-4728-3p	CLIP-seq
MIRT816670	hsa-miR-4731-5p	CLIP-seq
MIRT816671	hsa-miR-4741	CLIP-seq
MIRT816672	hsa-miR-4760-3p	CLIP-seq
MIRT816673	hsa-miR-503	CLIP-seq
MIRT816674	hsa-miR-5047	CLIP-seq
MIRT816675	hsa-miR-5095	CLIP-seq
MIRT816676	hsa-miR-597	CLIP-seq
MIRT816677	hsa-miR-600	CLIP-seq
MIRT816678	hsa-miR-604	CLIP-seq
MIRT816679	hsa-miR-634	CLIP-seq
MIRT816680	hsa-miR-647	CLIP-seq
MIRT816681	hsa-miR-664	CLIP-seq
MIRT816682	hsa-miR-711	CLIP-seq
MIRT816683	hsa-miR-762	CLIP-seq
MIRT816632	hsa-miR-101	CLIP-seq
MIRT816635	hsa-miR-122	CLIP-seq
MIRT816638	hsa-miR-1298	CLIP-seq
MIRT816640	hsa-miR-139-5p	CLIP-seq
MIRT816641	hsa-miR-144	CLIP-seq
MIRT816684	hsa-miR-1913	CLIP-seq
MIRT816650	hsa-miR-3120-3p	CLIP-seq
MIRT816651	hsa-miR-3135b	CLIP-seq
MIRT816685	hsa-miR-324-3p	CLIP-seq
MIRT816686	hsa-miR-3647-3p	CLIP-seq
MIRT816653	hsa-miR-3652	CLIP-seq
MIRT816655	hsa-miR-4283	CLIP-seq
MIRT816656	hsa-miR-4430	CLIP-seq
MIRT816659	hsa-miR-4489	CLIP-seq
MIRT816660	hsa-miR-4492	CLIP-seq
MIRT816661	hsa-miR-4498	CLIP-seq
MIRT816666	hsa-miR-4664-3p	CLIP-seq
MIRT816687	hsa-miR-4707-5p	CLIP-seq
MIRT816672	hsa-miR-4760-3p	CLIP-seq
MIRT816673	hsa-miR-503	CLIP-seq
MIRT816677	hsa-miR-600	CLIP-seq
MIRT816678	hsa-miR-604	CLIP-seq
MIRT816680	hsa-miR-647	CLIP-seq
MIRT816681	hsa-miR-664	CLIP-seq
MIRT816683	hsa-miR-762	CLIP-seq
MIRT1941519	hsa-miR-143	CLIP-seq
MIRT816649	hsa-miR-24	CLIP-seq
MIRT1941520	hsa-miR-4667-3p	CLIP-seq
MIRT1941521	hsa-miR-642a	CLIP-seq
MIRT816632	hsa-miR-101	CLIP-seq
MIRT2180259	hsa-miR-1236	CLIP-seq
MIRT816638	hsa-miR-1298	CLIP-seq
MIRT816640	hsa-miR-139-5p	CLIP-seq
MIRT1941519	hsa-miR-143	CLIP-seq
MIRT816641	hsa-miR-144	CLIP-seq
MIRT2180260	hsa-miR-1470	CLIP-seq
MIRT816649	hsa-miR-24	CLIP-seq
MIRT816650	hsa-miR-3120-3p	CLIP-seq
MIRT2180261	hsa-miR-323-5p	CLIP-seq
MIRT2180262	hsa-miR-3545-5p	CLIP-seq
MIRT816686	hsa-miR-3647-3p	CLIP-seq
MIRT816658	hsa-miR-4438	CLIP-seq
MIRT2180263	hsa-miR-4469	CLIP-seq
MIRT816662	hsa-miR-4505	CLIP-seq
MIRT2180264	hsa-miR-4529-5p	CLIP-seq
MIRT2180265	hsa-miR-4640-5p	CLIP-seq
MIRT816666	hsa-miR-4664-3p	CLIP-seq
MIRT1941520	hsa-miR-4667-3p	CLIP-seq
MIRT2180266	hsa-miR-4726-5p	CLIP-seq
MIRT816672	hsa-miR-4760-3p	CLIP-seq
MIRT816673	hsa-miR-503	CLIP-seq
MIRT816675	hsa-miR-5095	CLIP-seq
MIRT2180267	hsa-miR-541	CLIP-seq
MIRT816677	hsa-miR-600	CLIP-seq
MIRT1941521	hsa-miR-642a	CLIP-seq
MIRT816681	hsa-miR-664	CLIP-seq
MIRT816662	hsa-miR-4505	CLIP-seq
MIRT816637	hsa-miR-1289	CLIP-seq
MIRT2435635	hsa-miR-149	CLIP-seq
MIRT816662	hsa-miR-4505	CLIP-seq
MIRT2435636	hsa-miR-940	CLIP-seq

Show/Hide all (8)

Transcription factor	Regulation	Reference
CTCF	Unknown	20818159
E2F1	Activation	17263886
ETV6	Activation	16828711
FOXO3	Unknown	21654193
TCF3	Repression	23684607
TP53	Activation	17280505
TP53	Unknown	11572983;15988033;18755897;22763818
TP73	Activation	17700533

Show/Hide all (52)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	11463392
GO:0005515	Function	Protein binding	IPI	11463391, 11463392, 15694340, 16151013, 16608847, 16697956, 17177603, 17289999, 20153921, 20627101, 22516262, 26212789, 26431330, 28514442, 32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	11463391, 11463392
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	26212789
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005764	Component	Lysosome	IDA	26212789
GO:0005829	Component	Cytosol	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	IMP	26212789
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	ISS
GO:0008340	Process	Determination of adult lifespan	IEA
GO:0008340	Process	Determination of adult lifespan	ISS
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	21041309
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	22761832
GO:0034976	Process	Response to endoplasmic reticulum stress	IEA
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	IEA
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0051117	Function	ATPase binding	IPI	26212789
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IBA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	16407291
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	ISS
GO:0070227	Process	Lymphocyte apoptotic process	IEA
GO:0070230	Process	Positive regulation of lymphocyte apoptotic process	IEA
GO:0070231	Process	T cell apoptotic process	IEA
GO:0070234	Process	Positive regulation of T cell apoptotic process	IEA
GO:0070245	Process	Positive regulation of thymocyte apoptotic process	IEA
GO:0070245	Process	Positive regulation of thymocyte apoptotic process	ISS
GO:0071456	Process	Cellular response to hypoxia	IEP	20810912
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IBA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IGI	21041309
GO:0097190	Process	Apoptotic signaling pathway	IDA	11463392
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	17024184
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IEA
GO:0097194	Process	Execution phase of apoptosis	IBA
GO:0097194	Process	Execution phase of apoptosis	IDA	11463391, 11463392
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	TAS	22013210
GO:1903749	Process	Positive regulation of establishment of protein localization to mitochondrion	IEA
GO:1903896	Process	Positive regulation of IRE1-mediated unfolded protein response	TAS	22013210
GO:2000271	Process	Positive regulation of fibroblast apoptotic process	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IMP	17289999, 27031958
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
605854	17868	ENSG00000105327

Q96PG8

Protein name

Bcl-2-binding component 3, isoforms 3/4 (JFY-1) (p53 up-regulated modulator of apoptosis)

Protein function

[Isoform 3]: Does not affect cell growth.

Family and domains

Sequence

MKFGMGSAQACPCQVPRAASTTWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLP
ARPPGALGSVLRPLRARPGCRPRRPHPAARCLPLRPHRPTRRHRRPGGFPLAWGSPQPAP
RPAPGRSSALALAGGAAPGVARAQRPGGSGGRSHPGGPGSPRGGGTVGPGDRGPAAADGG
RPQRTVRAAETRGAAAAPPLTLEGPVQSHHGTPALTQGPQSPRDGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM

Sequence length

261

Q9BXH1

Protein name

Bcl-2-binding component 3, isoforms 1/2 (JFY-1) (p53 up-regulated modulator of apoptosis)

Protein function

Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis (PubMed:11463391, PubMed:23340338). Promotes partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53, releasing the bound p53/TP53 to induce apoptosis (PubM

PDB

2M04 , 4BPI , 4BPJ , 4BPK , 4HNJ , 5UUL , 6QFM , 6QG8 , 6TQP , 7DVD , 7P0S , 7P9W , 7QTX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15826	PUMA	2 → 193	Bcl-2-binding component 3, p53 upregulated modulator of apoptosis	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:11463391}.

Sequence

MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAAPAAPTLLPAAYLC
APTAPPAVTAALGGSRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPT
QAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLP
LPRGHRAPEMEPN

Sequence length

193

Interactions

View interactions

	KEGG		Reactome
	Platinum drug resistance p53 signaling pathway Apoptosis Apoptosis - multiple species Hippo signaling pathway Huntington disease Measles Pathways in cancer Colorectal cancer		BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members Activation of PUMA and translocation to mitochondria TP53 Regulates Transcription of Genes Involved in Cytochrome C Release FOXO-mediated transcription of cell death genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BURKITT LYMPHOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (163)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	17267315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	17267315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	28277192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	21859927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17934815		★★★★★ ★☆☆☆☆ Found in Text Mining only
African Burkitt`s lymphoma	African Burkitt`s Lymphoma	CTD_human_DG	18573879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	21859927, 28277192		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	17149756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	28682312		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23321162, 28803777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	21859927, 28277192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28747638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16447235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	40141133	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21739479, 24786146, 27878984, 28901386, 29180187, 29693134, 29769286, 30552702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25585941, 30443191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	19095966		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	18791823, 21383694, 24236056, 25395275, 25647720, 28099441, 28693277, 29227280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15756011, 20431602, 24073403, 26273641, 28099441, 34587475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19934289	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Leukemia	Burkitt`s Lymphoma	CTD_human_DG	18573879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	18573879, 26431330, 30119230		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	LHGDN	18573879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	CTD_human_DG	18573879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26431330, 28960205	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	26612445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17267315, 17393317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28692117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	28277192	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25635973, 29693134, 34123711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	29363716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25585941, 30443191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23339680, 23916609, 24012673, 26397233, 29030732, 29552188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	23321162, 25184537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25499216	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28692117	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26698248, 28423586, 30941896		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	31202167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	31202167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17934815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	21120639, 21339993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	17884151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	18556456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30601084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	21699775, 27718035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17263886, 19660860, 20812030, 25965911, 27924057, 28008149, 30185800, 30402948, 31182761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	18794091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11463391, 17393317, 18811981, 24763611, 28423513, 29344228, 29755130, 30402948, 31182761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	12574499, 15547745, 17393317, 18367875, 18811981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12574499, 15123817, 15262986, 16608847, 17263886, 17360476, 18367875, 18794091, 18811981, 19380879, 21855041, 22912816, 24610575, 26043078, 26631035, 36030982, 36508676 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	24763611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21268126, 25499216, 28692117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	16447235, 24566851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	15690057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18423823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	16481741		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	16481741	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31638164, 33034274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fulminant hepatitis	Fulminant Hepatitis	BEFREE	20413175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	24127039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	18615633, 20813046, 25625235, 29229477, 29593424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20153921, 37279651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18615633, 20813046, 25625235, 29229477, 29593424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18670645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	12963126, 19421143, 23220852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	12963126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23220852	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	26904937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	18215742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18670645	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34181359	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	40022042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36160033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31801607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18579560, 19737931, 25555870, 29179704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23996484, 27249593, 29723246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	18292124, 23192887, 26742432, 28703806, 29723246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	20737492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17121933, 17934815, 20413175, 30088967, 30712844, 30753820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17934815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	20413175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24012673, 27780918, 27878984, 34388376, 36224313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27492607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18573879, 26904937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	18573879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24660851	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	24660851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	29307600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	21092747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	15960600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	12963126, 19421143, 23220852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18791823, 21383694, 23532334, 24236056, 25395275, 25647720, 28099441, 28693277, 29227280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	16481741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	24127039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	17934815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12963126, 23339680, 23532334, 23916609, 24012673, 26397233, 27472460, 29030732, 29552188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	20737492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	26612445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	22086558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26698248, 28423586, 30941896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22312312, 22617775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18056181, 28454339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30524942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25585941, 30443191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12574499, 17393317, 18573879, 19641508, 22617775, 23001513, 24452416, 24481444, 26698248, 28277192, 28454339, 28903337, 29344228, 29592897, 29693134 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	31202167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17263886, 19660860, 20812030, 25965911, 27924057, 28008149, 30185800, 30402948, 31182761		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15690057, 16982766, 17263886, 21691232, 25365078, 26502640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17263886, 19620789, 20357812, 25365078, 27689874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	16127150, 19851330, 26043078, 36200643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28423586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26249174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	26742432		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26742432		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	21383694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	18838543	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26612445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	26612445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12963126, 15690057, 15960600, 16982766, 18573879, 18791823, 19540190, 20737492, 20813046, 21339993, 21859927, 22020090, 22617775, 23099885, 23220852 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	15803372, 16091745, 19241161, 21505869, 25644037, 29769286, 29959561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	16091745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	16091745, 21878749, 29959561, 31362335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25457551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27472460, 29352138, 30556447, 31190896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	22086558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	22086558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	14627843	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27649654		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26698248, 28423586, 30941896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21863213, 28423586, 32424251, 36122664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22312312, 22617775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	22312312, 22617775, 23321162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22312312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21909380, 23321162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	23321162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyp of large intestine	Polyp Of Large Intestine	BEFREE	29344228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	25784680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	28529565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18056181, 28454339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30577600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28277537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21268126, 25499216, 28692117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	22914294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16447235, 17014719, 28747638, 29383169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	36849535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36849535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36443881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	19033888		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	18056181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20737492, 27277529, 28338201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	16413463, 22086558, 23220852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	22086558, 23220852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	19638343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30524942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	17149756, 18838543	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28905491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	31506563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	31506563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29374168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tubular Aggregate Myopathy	Tubular Aggregate Myopathy	BEFREE	21383694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21699775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30443191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	36431966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BBC3 (BCL2 binding component 3)