Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27074
Gene name	Lysosomal associated membrane protein 3
Gene symbol	LAMP3
Synonyms (NCBI Gene)	CD208DC LAMPDC-LAMPDCLAMPLAMPLAMP-3TSC403
Chromosome	3
Chromosome location	3q27.1
Summary	Dendritic cells (DCs) are the most potent antigen-presenting cells. Immature DCs efficiently capture antigens and differentiate into interdigitating dendritic cells (IDCs) in lymphoid tissues that induce primary T-cell responses (summary by de Saint-Vis e

178

Show/Hide all (178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029868	hsa-miR-26b-5p	Microarray	19088304
MIRT702304	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT702305	hsa-miR-369-3p	HITS-CLIP	23313552
MIRT702303	hsa-miR-5692b	HITS-CLIP	23313552
MIRT702302	hsa-miR-5692c	HITS-CLIP	23313552
MIRT702301	hsa-miR-4796-5p	HITS-CLIP	23313552
MIRT702300	hsa-miR-374a-5p	HITS-CLIP	23313552
MIRT702299	hsa-miR-374b-5p	HITS-CLIP	23313552
MIRT702304	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT702305	hsa-miR-369-3p	HITS-CLIP	23313552
MIRT702303	hsa-miR-5692b	HITS-CLIP	23313552
MIRT702302	hsa-miR-5692c	HITS-CLIP	23313552
MIRT702301	hsa-miR-4796-5p	HITS-CLIP	23313552
MIRT702300	hsa-miR-374a-5p	HITS-CLIP	23313552
MIRT702299	hsa-miR-374b-5p	HITS-CLIP	23313552
MIRT1103647	hsa-miR-106a	CLIP-seq
MIRT1103648	hsa-miR-106b	CLIP-seq
MIRT1103649	hsa-miR-1273d	CLIP-seq
MIRT1103650	hsa-miR-142-5p	CLIP-seq
MIRT1103651	hsa-miR-17	CLIP-seq
MIRT1103652	hsa-miR-18a	CLIP-seq
MIRT1103653	hsa-miR-18b	CLIP-seq
MIRT1103654	hsa-miR-2053	CLIP-seq
MIRT1103655	hsa-miR-20a	CLIP-seq
MIRT1103656	hsa-miR-20b	CLIP-seq
MIRT1103657	hsa-miR-302a	CLIP-seq
MIRT1103658	hsa-miR-302b	CLIP-seq
MIRT1103659	hsa-miR-302c	CLIP-seq
MIRT1103660	hsa-miR-302d	CLIP-seq
MIRT1103661	hsa-miR-302e	CLIP-seq
MIRT1103662	hsa-miR-3128	CLIP-seq
MIRT1103663	hsa-miR-3176	CLIP-seq
MIRT1103664	hsa-miR-335	CLIP-seq
MIRT1103665	hsa-miR-339-5p	CLIP-seq
MIRT1103666	hsa-miR-34b	CLIP-seq
MIRT1103667	hsa-miR-3609	CLIP-seq
MIRT1103668	hsa-miR-3614-5p	CLIP-seq
MIRT1103669	hsa-miR-372	CLIP-seq
MIRT1103670	hsa-miR-373	CLIP-seq
MIRT1103671	hsa-miR-374a	CLIP-seq
MIRT1103672	hsa-miR-374b	CLIP-seq
MIRT1103673	hsa-miR-3922-3p	CLIP-seq
MIRT1103674	hsa-miR-3926	CLIP-seq
MIRT1103675	hsa-miR-4446-5p	CLIP-seq
MIRT1103676	hsa-miR-4522	CLIP-seq
MIRT1103677	hsa-miR-4659a-5p	CLIP-seq
MIRT1103678	hsa-miR-4659b-5p	CLIP-seq
MIRT1103679	hsa-miR-4720-5p	CLIP-seq
MIRT1103680	hsa-miR-4735-3p	CLIP-seq
MIRT1103681	hsa-miR-4755-5p	CLIP-seq
MIRT1103682	hsa-miR-4776-3p	CLIP-seq
MIRT1103683	hsa-miR-4792	CLIP-seq
MIRT1103684	hsa-miR-4796-3p	CLIP-seq
MIRT1103685	hsa-miR-4799-3p	CLIP-seq
MIRT1103686	hsa-miR-519d	CLIP-seq
MIRT1103687	hsa-miR-520a-3p	CLIP-seq
MIRT1103688	hsa-miR-520b	CLIP-seq
MIRT1103689	hsa-miR-520c-3p	CLIP-seq
MIRT1103690	hsa-miR-520d-3p	CLIP-seq
MIRT1103691	hsa-miR-520e	CLIP-seq
MIRT1103692	hsa-miR-520f	CLIP-seq
MIRT1103693	hsa-miR-548ah	CLIP-seq
MIRT1103694	hsa-miR-548s	CLIP-seq
MIRT1103695	hsa-miR-569	CLIP-seq
MIRT1103696	hsa-miR-577	CLIP-seq
MIRT1103697	hsa-miR-622	CLIP-seq
MIRT1103698	hsa-miR-658	CLIP-seq
MIRT1103699	hsa-miR-660	CLIP-seq
MIRT1103700	hsa-miR-670	CLIP-seq
MIRT1103701	hsa-miR-93	CLIP-seq
MIRT2028306	hsa-miR-1293	CLIP-seq
MIRT2028307	hsa-miR-142-3p	CLIP-seq
MIRT2028308	hsa-miR-3122	CLIP-seq
MIRT2028309	hsa-miR-3165	CLIP-seq
MIRT1103664	hsa-miR-335	CLIP-seq
MIRT2028310	hsa-miR-3622a-3p	CLIP-seq
MIRT2028311	hsa-miR-3622b-3p	CLIP-seq
MIRT2028312	hsa-miR-3689a-3p	CLIP-seq
MIRT2028313	hsa-miR-3689c	CLIP-seq
MIRT2028314	hsa-miR-3913-5p	CLIP-seq
MIRT2028315	hsa-miR-3929	CLIP-seq
MIRT2028316	hsa-miR-4419b	CLIP-seq
MIRT2028317	hsa-miR-4452	CLIP-seq
MIRT2028318	hsa-miR-4478	CLIP-seq
MIRT2028319	hsa-miR-4483	CLIP-seq
MIRT2028320	hsa-miR-4536	CLIP-seq
MIRT2028321	hsa-miR-4662a-5p	CLIP-seq
MIRT2028322	hsa-miR-4676-5p	CLIP-seq
MIRT2028323	hsa-miR-4728-5p	CLIP-seq
MIRT2028324	hsa-miR-4755-3p	CLIP-seq
MIRT2028325	hsa-miR-485-5p	CLIP-seq
MIRT2028326	hsa-miR-544b	CLIP-seq
MIRT2028327	hsa-miR-550a	CLIP-seq
MIRT2028328	hsa-miR-575	CLIP-seq
MIRT1103697	hsa-miR-622	CLIP-seq
MIRT2028329	hsa-miR-648	CLIP-seq
MIRT2028306	hsa-miR-1293	CLIP-seq
MIRT2028308	hsa-miR-3122	CLIP-seq
MIRT2259458	hsa-miR-3163	CLIP-seq
MIRT2028309	hsa-miR-3165	CLIP-seq
MIRT1103664	hsa-miR-335	CLIP-seq
MIRT2028310	hsa-miR-3622a-3p	CLIP-seq
MIRT2028311	hsa-miR-3622b-3p	CLIP-seq
MIRT2028312	hsa-miR-3689a-3p	CLIP-seq
MIRT2028313	hsa-miR-3689c	CLIP-seq
MIRT2028314	hsa-miR-3913-5p	CLIP-seq
MIRT2028315	hsa-miR-3929	CLIP-seq
MIRT2028316	hsa-miR-4419b	CLIP-seq
MIRT2028318	hsa-miR-4478	CLIP-seq
MIRT2028319	hsa-miR-4483	CLIP-seq
MIRT2259459	hsa-miR-4668-3p	CLIP-seq
MIRT2259460	hsa-miR-4722-5p	CLIP-seq
MIRT2028323	hsa-miR-4728-5p	CLIP-seq
MIRT2028325	hsa-miR-485-5p	CLIP-seq
MIRT2259461	hsa-miR-505	CLIP-seq
MIRT2028326	hsa-miR-544b	CLIP-seq
MIRT2028327	hsa-miR-550a	CLIP-seq
MIRT2028306	hsa-miR-1293	CLIP-seq
MIRT2390068	hsa-miR-24	CLIP-seq
MIRT2028308	hsa-miR-3122	CLIP-seq
MIRT2028312	hsa-miR-3689a-3p	CLIP-seq
MIRT2028313	hsa-miR-3689c	CLIP-seq
MIRT2028314	hsa-miR-3913-5p	CLIP-seq
MIRT2028315	hsa-miR-3929	CLIP-seq
MIRT2390069	hsa-miR-4284	CLIP-seq
MIRT2028316	hsa-miR-4419b	CLIP-seq
MIRT2028318	hsa-miR-4478	CLIP-seq
MIRT2028319	hsa-miR-4483	CLIP-seq
MIRT2028323	hsa-miR-4728-5p	CLIP-seq
MIRT2028325	hsa-miR-485-5p	CLIP-seq
MIRT2028306	hsa-miR-1293	CLIP-seq
MIRT2028308	hsa-miR-3122	CLIP-seq
MIRT2028309	hsa-miR-3165	CLIP-seq
MIRT1103664	hsa-miR-335	CLIP-seq
MIRT1103666	hsa-miR-34b	CLIP-seq
MIRT2559824	hsa-miR-3613-3p	CLIP-seq
MIRT1103668	hsa-miR-3614-5p	CLIP-seq
MIRT2028310	hsa-miR-3622a-3p	CLIP-seq
MIRT2028311	hsa-miR-3622b-3p	CLIP-seq
MIRT2028312	hsa-miR-3689a-3p	CLIP-seq
MIRT2028313	hsa-miR-3689c	CLIP-seq
MIRT2559825	hsa-miR-371-5p	CLIP-seq
MIRT2559826	hsa-miR-371b-5p	CLIP-seq
MIRT2028314	hsa-miR-3913-5p	CLIP-seq
MIRT2028315	hsa-miR-3929	CLIP-seq
MIRT2028316	hsa-miR-4419b	CLIP-seq
MIRT2028318	hsa-miR-4478	CLIP-seq
MIRT2028319	hsa-miR-4483	CLIP-seq
MIRT1103677	hsa-miR-4659a-5p	CLIP-seq
MIRT1103678	hsa-miR-4659b-5p	CLIP-seq
MIRT2259460	hsa-miR-4722-5p	CLIP-seq
MIRT2028323	hsa-miR-4728-5p	CLIP-seq
MIRT2559827	hsa-miR-4738-3p	CLIP-seq
MIRT2559828	hsa-miR-4768-3p	CLIP-seq
MIRT1103682	hsa-miR-4776-3p	CLIP-seq
MIRT2028325	hsa-miR-485-5p	CLIP-seq
MIRT2028326	hsa-miR-544b	CLIP-seq
MIRT1103698	hsa-miR-658	CLIP-seq
MIRT2028306	hsa-miR-1293	CLIP-seq
MIRT2028308	hsa-miR-3122	CLIP-seq
MIRT2028309	hsa-miR-3165	CLIP-seq
MIRT1103664	hsa-miR-335	CLIP-seq
MIRT2559824	hsa-miR-3613-3p	CLIP-seq
MIRT2028310	hsa-miR-3622a-3p	CLIP-seq
MIRT2028311	hsa-miR-3622b-3p	CLIP-seq
MIRT2028312	hsa-miR-3689a-3p	CLIP-seq
MIRT2028313	hsa-miR-3689c	CLIP-seq
MIRT2559825	hsa-miR-371-5p	CLIP-seq
MIRT2559826	hsa-miR-371b-5p	CLIP-seq
MIRT2028314	hsa-miR-3913-5p	CLIP-seq
MIRT2028315	hsa-miR-3929	CLIP-seq
MIRT2028316	hsa-miR-4419b	CLIP-seq
MIRT2028318	hsa-miR-4478	CLIP-seq
MIRT2028319	hsa-miR-4483	CLIP-seq
MIRT2028323	hsa-miR-4728-5p	CLIP-seq
MIRT2559827	hsa-miR-4738-3p	CLIP-seq
MIRT2028325	hsa-miR-485-5p	CLIP-seq
MIRT2028326	hsa-miR-544b	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IBA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	TAS	9721848
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21810281
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21810281
GO:0009986	Component	Cell surface	IEA
GO:0010506	Process	Regulation of autophagy	IMP	25681212
GO:0010628	Process	Positive regulation of gene expression	IMP	23651994
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	IBA
GO:0031982	Component	Vesicle	IDA	25681212
GO:0035455	Process	Response to interferon-alpha	IMP	23651994
GO:0046718	Process	Symbiont entry into host cell	IMP	21810281
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	25681212
GO:0072594	Process	Establishment of protein localization to organelle	IBA
GO:0097233	Component	Alveolar lamellar body membrane	ISS
GO:1901799	Process	Negative regulation of proteasomal protein catabolic process	IMP	25681212
GO:1903900	Process	Regulation of viral life cycle	IMP	21810281

MIM	HGNC	e!Ensembl
605883	14582	ENSG00000078081

Q9UQV4

Protein name

Lysosome-associated membrane glycoprotein 3 (LAMP-3) (Lysosomal-associated membrane protein 3) (DC-lysosome-associated membrane glycoprotein) (DC LAMP) (Protein TSC403) (CD antigen CD208)

Protein function

Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction (PubMed:25681212). Plays a role in the process of fusion of the ly

PDB

4AKM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01299	Lamp	223 → 366	Lysosome-associated membrane glycoprotein (Lamp)	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in tonsil interdigitating dendritic cells, in spleen, lymph node, Peyer's patches in the small instestine, in thymus medulla and in B-cells (at protein level). Expressed in lymphoid organs and dendritic cells. Expressed in lun

Sequence

MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAP
HQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPV
TEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKST
TGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKA
EMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEES
YYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQL
QAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI

Sequence length

416

Interactions

View interactions

	KEGG
	Lysosome

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS LEISHMANIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (80)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	17056097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20551384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11485903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	18292234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASDB_DG	21254220		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	21254220, 26503763		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	27759212		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	27759212	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	21319150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20678512, 23294542, 37747033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	28607528	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	37373062	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28349821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30584088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	29458095		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	16204031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	16204031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19074592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	11485903		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11485903, 25362357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35924107	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	32035984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37276865, 38217544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	35992117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	31311326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	31311326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26263981, 36434949, 36921563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	16597865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	25362357, 28607528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	10440752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	18368027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IIb	Glycogen Storage Disease	BEFREE	25589223, 30584088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	38217544	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermansky Pudlak syndrome 2	Hermansky-pudlak syndrome	Pubtator	27207797	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23294542, 37878884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26191259, 26263981, 28849219	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	24081865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	24462885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	24462885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21319150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	31311326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28349821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24045183, 30294508, 9721848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	16204031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21319150		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17606713		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30211163, 7531726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucolipidosis Type IV	Mucolipidosis	BEFREE	19117012		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	31002199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37373062	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16204031, 19726095, 21319150, 21884745, 24045183, 29526252, 30211163, 30968254, 31311326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	19297684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39778696	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28849219, 30008754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28849219	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30008754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28349821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28349821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	31541428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	GWASDB_DG	21738487		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	BEFREE	21812969, 23492776, 23496138, 24312176, 24631562, 26601739, 28840510, 30877973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	21812969, 24312176	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	22786590	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12571844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	18292234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	36377873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	21926974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sialic Acid Storage Disease, Finnish Type (disorder)	Sialic Acid Storage Disease	BEFREE	1959930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sialuria	Sialuria	BEFREE	1959930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	32939030, 34349764	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26263981, 30968254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26191259, 28607528, 37740656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29452206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25362357, 37215115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	23782575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34224371	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37512096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	24045183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	28607528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22684653		★★★★★ ★☆☆☆☆ Found in Text Mining only

LAMP3 (lysosomal associated membrane protein 3)