GJB3 (gap junction protein beta 3)

Gene

• Entrez ID: 2707
• Gene name: Gap junction protein beta 3
• Gene symbol: GJB3
• Synonyms (NCBI Gene): CX31, DFNA2, DFNA2B, EKV, EKVP1
• Chromosome: 1
• Chromosome location: 1p34.3
• Summary: This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. Muta

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023520	hsa-miR-1-3p	Microarray	18668037
MIRT1019779	hsa-miR-1298	CLIP-seq
MIRT1019780	hsa-miR-4690-3p	CLIP-seq
MIRT1019781	hsa-miR-554	CLIP-seq
MIRT1019779	hsa-miR-1298	CLIP-seq
MIRT1019780	hsa-miR-4690-3p	CLIP-seq
MIRT1019781	hsa-miR-554	CLIP-seq
MIRT1019779	hsa-miR-1298	CLIP-seq
MIRT2235017	hsa-miR-4268	CLIP-seq
MIRT2235018	hsa-miR-4419a	CLIP-seq
MIRT2235019	hsa-miR-4486	CLIP-seq
MIRT2235020	hsa-miR-4510	CLIP-seq
MIRT1019780	hsa-miR-4690-3p	CLIP-seq
MIRT2235021	hsa-miR-516b	CLIP-seq
MIRT1019781	hsa-miR-554	CLIP-seq
MIRT1019779	hsa-miR-1298	CLIP-seq
MIRT1019780	hsa-miR-4690-3p	CLIP-seq
MIRT1019781	hsa-miR-554	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001890	Process	Placenta development	IEA
GO:0005243	Function	Gap junction channel activity	IBA
GO:0005243	Function	Gap junction channel activity	NAS	9704026
GO:0005515	Function	Protein binding	IPI	32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005911	Component	Cell-cell junction	IEA
GO:0005921	Component	Gap junction	IEA
GO:0005921	Component	Gap junction	NAS	9704026
GO:0005922	Component	Connexin complex	IBA
GO:0005922	Component	Connexin complex	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007267	Process	Cell-cell signaling	IBA
GO:0016020	Component	Membrane	IEA
GO:0030054	Component	Cell junction	IDA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070161	Component	Anchoring junction	IEA

Other IDs

• MIM: 603324
• HGNC: 4285
• e!Ensembl: ENSG00000188910

Protein

• UniProt ID: O75712
• Protein name: Gap junction beta-3 protein (Connexin-31) (Cx31)
• Protein function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00029	Connexin	2 → 211	Connexin	Family

• Sequence:

  MDWKTLQALLSGVNKYSTAFGRIWLSVVFVFRVLVYVVAAERVWGDEQKDFDCNTKQPGC
  TNVCYDNYFPISNIRLWALQLIFVTCPSLLVILHVAYREERERRHRQKHGDQCAKLYDNA
  GKKHGGLWWTYLFSLIFKLIIEFLFLYLLHTLWHGFNMPRLVQCANVAPCPNIVDCYIAR
  PTEKKIFTYFMVGASAVCIVLTICELCYLICHRVLRGLHKDKPRGGCSPSSSASRASTCR
  CHHKLVEAGEVDPDPGNNKLQASAPNLTPI

• Sequence length: 270

Pathways

Reactome:

Gap junction assembly

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant nonsyndromic hearing loss 2B	Pathogenic	rs28937583	RCV004584593	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal recessive nonsyndromic hearing loss 1A	Pathogenic	rs1557659237	RCV000770824	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deafness, digenic, GJB2/GJB3	Pathogenic	rs121908851	RCV000006865	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Erythrokeratodermia variabilis et progressiva 1	Pathogenic	rs74315315, rs74315316, rs74315317, rs74315321, rs28937583	RCV000006855 RCV000006856 RCV000006857 RCV000006862 RCV000006864	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOSOMAL DOMINANT ISOLATED SENSORINEURAL DEAFNESS TYPE DFNA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT NONSYNDROMIC HEARING LOSS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL RECESSIVE ISOLATED SENSORINEURAL DEAFNESS TYPE DFNB	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autosomal recessive nonsyndromic hearing loss 8	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 2B	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, autosomal dominant, with peripheral neuropathy	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DEAFNESS, AUTOSOMAL RECESSIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL RECESSIVE 1A	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, CHILDHOOD-ONSET NEUROSENSORY, AUTOSOMAL RECESSIVE 8	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, DIGENIC, GJB2-GJB3	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erythrokeratodermia variabilis	Uncertain significance	ClinVar CTD, ClinGen, ClinVar, Disgenet, Orphanet CTD, ClinGen, ClinVar, Disgenet, Orphanet CTD, ClinGen, ClinVar, Disgenet, Orphanet CTD, ClinGen, ClinVar, Disgenet, Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GJB3-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GREITHER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing impairment	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hearing loss, autosomal recessive	Uncertain significance	ClinVar GWAS catalog	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
NEUROPATHY WITH HEARING IMPAIRMENT	—	GenCC, Orphanet GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic Deafness	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic Hearing Loss, Dominant	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY WITH SENSORINEURAL HEARING IMPAIRMENT SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS OF BILATERAL EARS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic sensorineural deafness type DFNA	Non-Syndromic Sensorineural Deafness	Orphanet			★☆☆☆☆ Found in Text Mining only
Autosomal recessive non-syndromic sensorineural deafness type DFNB	Non-Syndromic Sensorineural Deafness	Orphanet			★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Charcot-Marie-Tooth Disease	Charcot-Marie-Tooth Disease	BEFREE	10767631		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32322884	Associate	★☆☆☆☆ Found in Text Mining only
Congenital sensorineural hearing loss	Congenital Sensorineural Hearing Loss	BEFREE	15140211		★☆☆☆☆ Found in Text Mining only
Deaf Mutism	Deafness	CTD_human_DG	9843210		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	21917135, 22534022, 28151902, 28717060, 29926981, 30036422, 30235673, 30973918, 31250571, 31345197, 31992338, 38172182, 38172427, 39700758	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, Acquired	Deafness	CTD_human_DG	9843210		★☆☆☆☆ Found in Text Mining only
Deafness, Autosomal Dominant 2B	Deafness	GENOMICS_ENGLAND_DG	9843210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, Autosomal Dominant 2B	Deafness	UNIPROT_DG	9843210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, Autosomal Dominant 2B	Deafness	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Deafness, Autosomal Dominant 2B	Deafness	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT, WITH PERIPHERAL NEUROPATHY	Deafness	GENOMICS_ENGLAND_DG	9843210		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DEAFNESS, AUTOSOMAL RECESSIVE (disorder)	Deafness	GENOMICS_ENGLAND_DG	9843210		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE (disorder)	Deafness	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 1A (disorder)	Deafness	GENOMICS_ENGLAND_DG	9843210		★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 1A (disorder)	Deafness	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL RECESSIVE 1A (disorder)	Deafness	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
DEAFNESS, DIGENIC, GJB2/GJB3 (disorder)	DEAFNESS, DIGENIC	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
DEAFNESS, DIGENIC, GJB2/GJB3 (disorder)	DEAFNESS, DIGENIC	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
DEAFNESS, DIGENIC, GJB2/GJB6 (disorder)	DEAFNESS, DIGENIC	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	10594760, 10757647, 10888284, 11933201, 12165562, 12702148, 14681040, 16297190, 16549784, 19755382, 21834795		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	LHGDN	12165562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16372802		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
EPILEPSY, BENIGN NEONATAL, 2	Epilepsy	BEFREE	18061539		★☆☆☆☆ Found in Text Mining only
Erythrokeratoderma	Erythrokeratoderma	BEFREE	10594760, 11122035, 12165562, 16297190, 19755382, 21188847, 21564177, 21920315		★☆☆☆☆ Found in Text Mining only
Erythrokeratoderma	Erythrokeratoderma	GENOMICS_ENGLAND_DG	10594760		★☆☆☆☆ Found in Text Mining only
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	CLINGEN_DG	10594760, 10798362, 12176042, 15948974, 18482034, 21188847, 21879244, 21920315, 21950330, 22393412, 22681493, 23442023, 25297803, 26251042, 26632638, 9843209		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	GENOMICS_ENGLAND_DG	10594760, 10798362, 9843209		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	BEFREE	10798362, 11017804, 11309368, 12019212, 12165562, 12702148, 14583444, 15131355, 15948974, 16077902, 17446259, 22266302, 22393412, 25964267, 26251042, 29044474, 29570224, 9843209		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Erythrokeratodermia Variabilis	Erythrokeratodermia variabilis	Pubtator	11017804, 12648223, 14594578, 16077902, 22393412, 25964267, 30924322	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	ORPHANET_DG	21564177		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	Orphanet			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Erythrokeratodermia variabilis	Erythrokeratodermia Variabilis	CTD_human_DG	9843209		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ERYTHROKERATODERMIA VARIABILIS ET PROGRESSIVA 1	Erythrokeratodermia Variabilis Et Progressiva	UNIPROT_DG	10594760, 10798362, 9843209		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ERYTHROKERATODERMIA VARIABILIS ET PROGRESSIVA 1	Erythrokeratodermia Variabilis Et Progressiva	GENOMICS_ENGLAND_DG	10594760, 10798362, 9843209, 9843210		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
ERYTHROKERATODERMIA VARIABILIS ET PROGRESSIVA 1	Erythrokeratodermia Variabilis Et Progressiva	CLINVAR_DG			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Glaucoma	Glaucoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Greither Disease	Erythrokeratodermia variabilis	CTD_human_DG	9843209		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing Loss	Hearing loss	Pubtator	14681040, 16077902, 19755382, 22617145, 29707576, 29926981, 30036422, 37801830	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	15140211, 21254920, 30036422, 35580552	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss, High-Frequency	Hearing Loss	BEFREE	12173596, 29106878, 9843210		★☆☆☆☆ Found in Text Mining only
Hearing Loss, High-Frequency	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	BEFREE	12648223		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis, Epidermolytic	Hyperkeratosis, Epidermolytic	CTD_human_DG	16297190		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratitis Ichthyosis Deafness Syndrome	Keratitis ichthyosis deafness syndrome	Pubtator	15140211	Associate	★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	15668823		★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	BEFREE	11175290		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29747774		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22393412	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	19755382	Associate	★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	11309368, 15276679, 19755382		★☆☆☆☆ Found in Text Mining only
Neuropathy with hearing impairment	Neuropathy With Hearing Impairment	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nodular Sclerosis Classical Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	23256547, 30235673, 30556268		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	10925378, 15131355, 17259707, 18607988, 20593197, 22154049, 22617145, 24913888, 27176802, 29739174, 30556268, 30589569		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic Deafness	Nonsyndromic Deafness	CLINGEN_DG	11309368, 12630965, 12791041, 15131355, 17259707, 19744334, 22617145, 25214170, 9843210		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonsyndromic Deafness	Nonsyndromic Deafness	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Patchy palmoplantar keratoderma	Patchy palmoplantar keratoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	GENOMICS_ENGLAND_DG	10594760		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11309368, 12165562, 16077902, 19755382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	11309368		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	16077902, 19755382	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	11309368, 12165562, 16077902, 19755382		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prelingual Deafness	Deafness	CTD_human_DG	9843210		★☆☆☆☆ Found in Text Mining only
Profound hearing impairment	Hearing Impairment	BEFREE	29739174		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	11309368, 12165562, 15276679, 22617145, 29739174		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	CTD_human_DG	11309368		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensory hearing loss	Hearing Loss	CTD_human_DG	11309368		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	14681040, 16297190, 19755382	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases Genetic	Skin disease	Pubtator	10594760	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	15668823		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29747774	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29747774		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29747774		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	29747774	Inhibit	★☆☆☆☆ Found in Text Mining only
Usher Syndromes	Usher syndrome	Pubtator	35580552	Associate	★☆☆☆☆ Found in Text Mining only