SND1 (staphylococcal nuclease and tudor domain containing 1)

Gene

• Entrez ID: 27044
• Gene name: Staphylococcal nuclease and tudor domain containing 1
• Gene symbol: SND1
• Synonyms (NCBI Gene): TDRD11, TSN, Tudor-SN, p100
• Chromosome: 7
• Chromosome location: 7q32.1
• Summary: This gene encodes a transcriptional co-activator that interacts with the acidic domain of Epstein-Barr virus nuclear antigen 2 (EBNA 2), a transcriptional activator that is required for B-lymphocyte transformation. Other transcription factors that interac

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT029612	hsa-miR-26b-5p	Microarray	19088304
MIRT051278	hsa-miR-16-5p	CLASH	23622248
MIRT048839	hsa-miR-93-5p	CLASH	23622248
MIRT036835	hsa-miR-877-3p	CLASH	23622248
MIRT438339	hsa-miR-361-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	25965817
MIRT438339	hsa-miR-361-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	25965817
MIRT438339	hsa-miR-361-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	25965817
MIRT438339	hsa-miR-361-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	25965817
MIRT641891	hsa-miR-1470	HITS-CLIP	23824327
MIRT641890	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT641889	hsa-miR-5009-3p	HITS-CLIP	23824327
MIRT641888	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT641887	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT641886	hsa-miR-4469	HITS-CLIP	23824327
MIRT641885	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT641884	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT641883	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT641882	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT641881	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT467439	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT467440	hsa-miR-4270	PAR-CLIP	23592263
MIRT467438	hsa-miR-4441	PAR-CLIP	23592263
MIRT467437	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT467436	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT467435	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT467434	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT467433	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT467432	hsa-miR-4434	PAR-CLIP	23592263
MIRT467431	hsa-miR-4516	PAR-CLIP	23592263
MIRT467430	hsa-miR-5703	PAR-CLIP	23592263
MIRT467428	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT467429	hsa-miR-198	PAR-CLIP	23592263
MIRT731070	hsa-miR-184	qRT-PCR, Luciferase reporter assay, Immunofluorescence, Immunohistochemistry, Western blot	25216670
MIRT731070	hsa-miR-184	qRT-PCR, Luciferase reporter assay, Immunofluorescence, Immunohistochemistry, Western blot	25216670
MIRT736681	hsa-miR-296-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR	33652459
MIRT641891	hsa-miR-1470	HITS-CLIP	23824327
MIRT641890	hsa-miR-4667-3p	HITS-CLIP	23824327
MIRT641889	hsa-miR-5009-3p	HITS-CLIP	23824327
MIRT641888	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT641887	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT641886	hsa-miR-4469	HITS-CLIP	23824327
MIRT641885	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT641884	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT641883	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT641882	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT641881	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT467439	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT467440	hsa-miR-4270	PAR-CLIP	23592263
MIRT467438	hsa-miR-4441	PAR-CLIP	23592263
MIRT467437	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT467436	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT467435	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT467434	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT467433	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT467432	hsa-miR-4434	PAR-CLIP	23592263
MIRT467431	hsa-miR-4516	PAR-CLIP	23592263
MIRT467430	hsa-miR-5703	PAR-CLIP	23592263
MIRT467428	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT467429	hsa-miR-198	PAR-CLIP	23592263
MIRT1375447	hsa-miR-3192	CLIP-seq
MIRT1375448	hsa-miR-3616-3p	CLIP-seq
MIRT1375449	hsa-miR-4314	CLIP-seq
MIRT1375450	hsa-miR-4436b-3p	CLIP-seq
MIRT1375451	hsa-miR-4487	CLIP-seq
MIRT1375452	hsa-miR-4646-5p	CLIP-seq
MIRT1375453	hsa-miR-548aa	CLIP-seq
MIRT1375454	hsa-miR-622	CLIP-seq
MIRT1375447	hsa-miR-3192	CLIP-seq
MIRT1375448	hsa-miR-3616-3p	CLIP-seq
MIRT1553879	hsa-miR-421	CLIP-seq
MIRT1375449	hsa-miR-4314	CLIP-seq
MIRT1375450	hsa-miR-4436b-3p	CLIP-seq
MIRT1375451	hsa-miR-4487	CLIP-seq
MIRT1553880	hsa-miR-4520a-3p	CLIP-seq
MIRT1553881	hsa-miR-4520b-3p	CLIP-seq
MIRT1375452	hsa-miR-4646-5p	CLIP-seq
MIRT1553882	hsa-miR-4709-5p	CLIP-seq
MIRT1375454	hsa-miR-622	CLIP-seq
MIRT2111639	hsa-miR-1827	CLIP-seq
MIRT1375447	hsa-miR-3192	CLIP-seq
MIRT1553879	hsa-miR-421	CLIP-seq
MIRT1375449	hsa-miR-4314	CLIP-seq
MIRT1553880	hsa-miR-4520a-3p	CLIP-seq
MIRT1553881	hsa-miR-4520b-3p	CLIP-seq
MIRT1375452	hsa-miR-4646-5p	CLIP-seq
MIRT1553882	hsa-miR-4709-5p	CLIP-seq
MIRT2111640	hsa-miR-548c-3p	CLIP-seq
MIRT1375454	hsa-miR-622	CLIP-seq
MIRT2111641	hsa-miR-940	CLIP-seq
MIRT2334811	hsa-miR-1256	CLIP-seq
MIRT2334812	hsa-miR-1324	CLIP-seq
MIRT2334813	hsa-miR-3158-5p	CLIP-seq
MIRT2334814	hsa-miR-3166	CLIP-seq
MIRT2334815	hsa-miR-3170	CLIP-seq
MIRT2334816	hsa-miR-4446-3p	CLIP-seq
MIRT2334817	hsa-miR-4771	CLIP-seq
MIRT2111640	hsa-miR-548c-3p	CLIP-seq
MIRT2334818	hsa-miR-580	CLIP-seq
MIRT2691611	hsa-miR-1283	CLIP-seq
MIRT2334815	hsa-miR-3170	CLIP-seq
MIRT2691612	hsa-miR-3183	CLIP-seq
MIRT2691613	hsa-miR-320a	CLIP-seq
MIRT2691614	hsa-miR-320b	CLIP-seq
MIRT2691615	hsa-miR-320c	CLIP-seq
MIRT2691616	hsa-miR-320d	CLIP-seq
MIRT2691617	hsa-miR-320e	CLIP-seq
MIRT2691618	hsa-miR-326	CLIP-seq
MIRT2691619	hsa-miR-330-5p	CLIP-seq
MIRT2691620	hsa-miR-4429	CLIP-seq
MIRT2691621	hsa-miR-4667-5p	CLIP-seq
MIRT2691622	hsa-miR-4700-5p	CLIP-seq
MIRT2691623	hsa-miR-4723-3p	CLIP-seq
MIRT2691624	hsa-miR-637	CLIP-seq
MIRT2691625	hsa-miR-711	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
NFKB2	Activation	20363924

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003712	Function	Transcription coregulator activity	TAS	7651391
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	18453631
GO:0004518	Function	Nuclease activity	IBA
GO:0004518	Function	Nuclease activity	IEA
GO:0004519	Function	Endonuclease activity	IDA	18453631
GO:0004519	Function	Endonuclease activity	IEA
GO:0004521	Function	RNA endonuclease activity	IDA	28546213
GO:0005515	Function	Protein binding	IPI	20643132, 20937909, 24882364, 24981741, 28514442, 28546213, 33961781, 34591612
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7651391
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006402	Process	MRNA catabolic process	IBA
GO:0010564	Process	Regulation of cell cycle process	IMP	28546213
GO:0010587	Process	MiRNA catabolic process	IDA	28546213
GO:0016020	Component	Membrane	HDA	16210410
GO:0016787	Function	Hydrolase activity	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031332	Component	RNAi effector complex	IEA
GO:0042470	Component	Melanosome	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0097433	Component	Dense body	IEA
GO:1905172	Function	RISC complex binding	IDA	28546213

Other IDs

• MIM: 602181
• HGNC: 30646
• e!Ensembl: ENSG00000197157

Protein

• UniProt ID: Q7KZF4
• Protein name: Staphylococcal nuclease domain-containing protein 1 (EC 3.1.31.1) (100 kDa coactivator) (EBNA2 coactivator p100) (Tudor domain-containing protein 11) (p100 co-activator)
• Protein function: Endonuclease that mediates miRNA decay of both protein-free and AGO2-loaded miRNAs (PubMed:18453631, PubMed:28546213). As part of its function in miRNA decay, regulates mRNAs involved in G1-to-S phase transition (PubMed:28546213). Functions as a
• PDB: 2E6N, 2HQE, 2HQX, 2O4X, 3BDL, 3OMC, 3OMG, 4QMG, 5M9O, 7KNW, 7KNX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00565	SNase	48 → 166	Staphylococcal nuclease homologue	Domain
  PF00565	SNase	220 → 328	Staphylococcal nuclease homologue	Domain
  PF00565	SNase	367 → 496	Staphylococcal nuclease homologue	Domain
  PF00565	SNase	552 → 660	Staphylococcal nuclease homologue	Domain
  PF00567	TUDOR	677 → 799	Tudor domain	Domain
  PF00565	SNase	837 → 895	Staphylococcal nuclease homologue	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. {ECO:0000269|PubMed:7651391}.
• Sequence:

  MASSAQSGGSSGGPAVPTVQRGIIKMVLSGCAIIVRGQPRGGPPPERQINLSNIRAGNLA
  RRAAATQPDAKDTPDEPWAFPAREFLRKKLIGKEVCFTIENKTPQGREYGMIYLGKDTNG
  ENIAESLVAEGLATRREGMRANNPEQNRLSECEEQAKAAKKGMWSEGNGSHTIRDLKYTI
  ENPRHFVDSHHQKPVNAIIEHVRDGSVVRALLLPDYYLVTVMLSGIKCPTFRREADGSET
  PEPFAAEAKFFTESRLLQRDVQIILESCHNQNILGTILHPNGNITELLLKEGFARCVDWS
  IAVYTRGAEKLRAAERFAKERRLRIWRDYVAPTANLDQKDKQFVAKVMQVLNADAIVVKL
  NSGDYKTIHLSSIRPPRLEGENTQDKNKKLRPLYDIPYMFEAREFLRKKLIGKKVNVTVD
  YIRPASPATETVPAFSERTCATVTIGGINIAEALVSKGLATVIRYRQDDDQRSSHYDELL
  AAEARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRL
  KLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKELVLQREVEVEVES
  MDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQKKEKVWAH
  YEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIAS
  HPPVEGSYAPRRGEFCIAKFVDGEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTL
  SPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEHLSAGCPHV
  TLQFADSKGDVGLGLVKEGLVMVEVRKEKQFQKVITEYLNAQESAKSARLNLWRYGDFRA
  DDADEFGYSR

• Sequence length: 910

Pathways

KEGG:

Viral carcinogenesis

Reactome:

Signaling by BRAF and RAF fusions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC BEHAVIOR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SND1-related disorder	Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Teratoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25985019		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	17909068		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	8289813		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	31377428	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	30415249		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	30415249		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20442744		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	20442744, 31085274		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	20442744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	20442744	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	29981961		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	19770515		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21478147, 24155205, 28190248, 28263968, 30216461, 9681829		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24155205, 35121988, 37885030	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	32581102	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26323317, 27183912	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22396537, 25494629, 30321081	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29159900		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	31978894	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25793711		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	18348187		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	32241273	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	27955827		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17909068, 23878061		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17909068		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32645525	Associate	★☆☆☆☆ Found in Text Mining only
Color blindness	Color Blindness	BEFREE	10447644		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25965817, 31579913		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23867710, 37779184	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28392940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28392940		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30116745		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	20889926, 28368397		★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	19642973		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31085274		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30647452		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	30138396		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25216670, 26351803, 30214229, 30753603		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28160566, 31253583, 36213325, 37202791	Associate	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28634830		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25494629	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30099509		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	31647415		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35299281	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	35299281	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	8289813		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31452252		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	11126370, 9989822		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12532453		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23878061, 25216670, 25405367, 26323317, 26997225, 27238764, 28428278, 29296233, 30321081		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26323317		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	25940438		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	29159900	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	10713675		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	12532453		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	10713675		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	25216670, 25405367, 28160566, 30214229		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21478147, 24155205, 28190248, 28263968, 30216461, 9681829		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30321081		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	25940438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29159900		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31452252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19435788, 23995791		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25965817		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19435788, 23878061, 26112410, 26351803, 28428278, 30365124, 30509125, 30945018, 7663511, 9294613		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17909068, 20883704, 23878061		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28190248		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	32645525	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10713675, 23211527, 28789366		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30506120, 31172825		★☆☆☆☆ Found in Text Mining only
MYASTHENIC SYNDROME, CONGENITAL, 7, PRESYNAPTIC	Myasthenic Syndrome	BEFREE	28638727		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11126370, 19351823, 23878061, 24981741, 25216670, 25494629, 26997225, 28160566, 28428278, 29159900, 30099509, 30216461, 30365124		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	31796527		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25940438		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	29618326		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	30506120, 31796527		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	19770515		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30365124		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31799644	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34476331	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	29740830		★☆☆☆☆ Found in Text Mining only
Phenylketonurias	Phenylketonuria	BEFREE	31284588		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	7947454		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19435788, 23995791		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19435788, 25189356, 28403887, 35659274	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34969359	Associate	★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	19770515		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30647452		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25965817		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35739527	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	32645525	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32737449	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37885030	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	36453257, 38176295	Associate	★☆☆☆☆ Found in Text Mining only