Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27034
Gene name	Acyl-CoA dehydrogenase family member 8
Gene symbol	ACAD8
Synonyms (NCBI Gene)	ACAD-8ARC42IBDH
Chromosome	11
Chromosome location	11q25
Summary	This gene encodes a member of the acyl-CoA dehydrogenase family of enzymes that catalyze the dehydrogenation of acyl-CoA derivatives in the metabolism of fatty acids or branch chained amino acids. The encoded protein is a mitochondrial enzyme that functio

Show/Hide all (17)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113488591	C>G	Uncertain-significance, benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs121908418	T>C	Pathogenic	Coding sequence variant, missense variant
rs121908419	G>A	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant, 3 prime UTR variant
rs121908420	C>T	Likely-pathogenic, uncertain-significance	Coding sequence variant, missense variant, 3 prime UTR variant
rs121908421	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, missense variant, 3 prime UTR variant
rs121908422	G>A,C	Uncertain-significance, pathogenic	Coding sequence variant, missense variant, 3 prime UTR variant
rs200620279	G>A	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant, 3 prime UTR variant
rs367857040	G>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs374317179	G>A	Pathogenic-likely-pathogenic	Missense variant, coding sequence variant, initiator codon variant
rs398124269	->CT	Pathogenic	Coding sequence variant, frameshift variant
rs751633406	G>A	Uncertain-significance, likely-pathogenic	Intron variant, 5 prime UTR variant, coding sequence variant, missense variant
rs767613745	T>C	Likely-pathogenic	Intron variant, upstream transcript variant, genic upstream transcript variant, coding sequence variant, missense variant
rs777756488	G>A	Pathogenic	Splice donor variant
rs778203609	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs779385985	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs1555067461	G>C	Likely-pathogenic	Splice donor variant, 3 prime UTR variant
rs1591505809	C>T	Pathogenic	Genic upstream transcript variant, coding sequence variant, stop gained, upstream transcript variant, synonymous variant

133

Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052639	hsa-let-7a-5p	CLASH	23622248
MIRT685425	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT685424	hsa-miR-548n	HITS-CLIP	23313552
MIRT685423	hsa-miR-6732-3p	HITS-CLIP	23313552
MIRT685422	hsa-miR-562	HITS-CLIP	23313552
MIRT685421	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT685420	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT685419	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT685418	hsa-miR-4421	HITS-CLIP	23313552
MIRT685417	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT685416	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT685415	hsa-miR-593-3p	HITS-CLIP	23313552
MIRT685414	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT685413	hsa-miR-6818-3p	HITS-CLIP	23313552
MIRT648984	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT648983	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT648982	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT648981	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT648979	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT648980	hsa-miR-1976	HITS-CLIP	23824327
MIRT648978	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT648977	hsa-miR-4486	HITS-CLIP	23824327
MIRT648976	hsa-miR-4252	HITS-CLIP	23824327
MIRT648975	hsa-miR-1254	HITS-CLIP	23824327
MIRT648974	hsa-miR-3116	HITS-CLIP	23824327
MIRT648973	hsa-miR-661	HITS-CLIP	23824327
MIRT648972	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT648971	hsa-miR-7703	HITS-CLIP	23824327
MIRT648970	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT685425	hsa-miR-548c-3p	HITS-CLIP	23313552
MIRT685424	hsa-miR-548n	HITS-CLIP	23313552
MIRT685423	hsa-miR-6732-3p	HITS-CLIP	23313552
MIRT685422	hsa-miR-562	HITS-CLIP	23313552
MIRT685421	hsa-miR-10a-5p	HITS-CLIP	23313552
MIRT685420	hsa-miR-10b-5p	HITS-CLIP	23313552
MIRT685419	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT685418	hsa-miR-4421	HITS-CLIP	23313552
MIRT685417	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT685416	hsa-miR-6895-3p	HITS-CLIP	23313552
MIRT685415	hsa-miR-593-3p	HITS-CLIP	23313552
MIRT685414	hsa-miR-4684-5p	HITS-CLIP	23313552
MIRT685413	hsa-miR-6818-3p	HITS-CLIP	23313552
MIRT648984	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT648983	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT648982	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT648981	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT648979	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT648980	hsa-miR-1976	HITS-CLIP	23824327
MIRT648978	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT648977	hsa-miR-4486	HITS-CLIP	23824327
MIRT648976	hsa-miR-4252	HITS-CLIP	23824327
MIRT648975	hsa-miR-1254	HITS-CLIP	23824327
MIRT648974	hsa-miR-3116	HITS-CLIP	23824327
MIRT648973	hsa-miR-661	HITS-CLIP	23824327
MIRT648972	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT648971	hsa-miR-7703	HITS-CLIP	23824327
MIRT648970	hsa-miR-550b-2-5p	HITS-CLIP	23824327
MIRT761430	hsa-miR-129-3p	CLIP-seq
MIRT761431	hsa-miR-3613-3p	CLIP-seq
MIRT761432	hsa-miR-3973	CLIP-seq
MIRT761433	hsa-miR-4272	CLIP-seq
MIRT761434	hsa-miR-4690-3p	CLIP-seq
MIRT761435	hsa-miR-4780	CLIP-seq
MIRT761436	hsa-miR-4795-3p	CLIP-seq
MIRT761437	hsa-miR-4804-5p	CLIP-seq
MIRT761438	hsa-miR-520g	CLIP-seq
MIRT761439	hsa-miR-520h	CLIP-seq
MIRT1924514	hsa-miR-181a	CLIP-seq
MIRT1924515	hsa-miR-181b	CLIP-seq
MIRT1924516	hsa-miR-181c	CLIP-seq
MIRT1924517	hsa-miR-181d	CLIP-seq
MIRT1924518	hsa-miR-4257	CLIP-seq
MIRT1924519	hsa-miR-4262	CLIP-seq
MIRT2165750	hsa-miR-3665	CLIP-seq
MIRT2165751	hsa-miR-4266	CLIP-seq
MIRT2165752	hsa-miR-657	CLIP-seq
MIRT2468332	hsa-miR-1228	CLIP-seq
MIRT2468333	hsa-miR-1260	CLIP-seq
MIRT2468334	hsa-miR-1260b	CLIP-seq
MIRT2468335	hsa-miR-1324	CLIP-seq
MIRT2468336	hsa-miR-136	CLIP-seq
MIRT2468337	hsa-miR-1825	CLIP-seq
MIRT2468338	hsa-miR-188-3p	CLIP-seq
MIRT2468339	hsa-miR-199a-5p	CLIP-seq
MIRT2468340	hsa-miR-199b-5p	CLIP-seq
MIRT2468341	hsa-miR-2355-5p	CLIP-seq
MIRT2468342	hsa-miR-3121-5p	CLIP-seq
MIRT2468343	hsa-miR-3125	CLIP-seq
MIRT2468344	hsa-miR-3127-3p	CLIP-seq
MIRT2468345	hsa-miR-3156-3p	CLIP-seq
MIRT2468346	hsa-miR-3616-3p	CLIP-seq
MIRT2468347	hsa-miR-3679-3p	CLIP-seq
MIRT2468348	hsa-miR-3916	CLIP-seq
MIRT2468349	hsa-miR-3923	CLIP-seq
MIRT2468350	hsa-miR-4276	CLIP-seq
MIRT2468351	hsa-miR-4459	CLIP-seq
MIRT2468352	hsa-miR-4691-5p	CLIP-seq
MIRT2468353	hsa-miR-4711-5p	CLIP-seq
MIRT2468354	hsa-miR-4713-3p	CLIP-seq
MIRT2468355	hsa-miR-4761-3p	CLIP-seq
MIRT2468356	hsa-miR-4779	CLIP-seq
MIRT2468357	hsa-miR-628-3p	CLIP-seq
MIRT2468358	hsa-miR-873	CLIP-seq
MIRT2468359	hsa-miR-877	CLIP-seq
MIRT2468332	hsa-miR-1228	CLIP-seq
MIRT2468333	hsa-miR-1260	CLIP-seq
MIRT2468334	hsa-miR-1260b	CLIP-seq
MIRT2468335	hsa-miR-1324	CLIP-seq
MIRT2468336	hsa-miR-136	CLIP-seq
MIRT2468337	hsa-miR-1825	CLIP-seq
MIRT2468338	hsa-miR-188-3p	CLIP-seq
MIRT2468339	hsa-miR-199a-5p	CLIP-seq
MIRT2468340	hsa-miR-199b-5p	CLIP-seq
MIRT2468341	hsa-miR-2355-5p	CLIP-seq
MIRT2468342	hsa-miR-3121-5p	CLIP-seq
MIRT2468343	hsa-miR-3125	CLIP-seq
MIRT2468344	hsa-miR-3127-3p	CLIP-seq
MIRT2468345	hsa-miR-3156-3p	CLIP-seq
MIRT2468346	hsa-miR-3616-3p	CLIP-seq
MIRT2674209	hsa-miR-3662	CLIP-seq
MIRT2468347	hsa-miR-3679-3p	CLIP-seq
MIRT2468348	hsa-miR-3916	CLIP-seq
MIRT2468349	hsa-miR-3923	CLIP-seq
MIRT2468350	hsa-miR-4276	CLIP-seq
MIRT2468351	hsa-miR-4459	CLIP-seq
MIRT2468352	hsa-miR-4691-5p	CLIP-seq
MIRT2468353	hsa-miR-4711-5p	CLIP-seq
MIRT2468354	hsa-miR-4713-3p	CLIP-seq
MIRT2468355	hsa-miR-4761-3p	CLIP-seq
MIRT2468356	hsa-miR-4779	CLIP-seq
MIRT2468357	hsa-miR-628-3p	CLIP-seq
MIRT2468358	hsa-miR-873	CLIP-seq
MIRT2468359	hsa-miR-877	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003853	Function	Short-chain 2-methyl fatty acyl-CoA dehydrogenase activity	IEA
GO:0003995	Function	Acyl-CoA dehydrogenase activity	IEA
GO:0003995	Function	Acyl-CoA dehydrogenase activity	TAS	10524212
GO:0005515	Function	Protein binding	IPI	33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	TAS
GO:0006574	Process	L-valine catabolic process	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	10524212
GO:0009083	Process	Branched-chain amino acid catabolic process	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016627	Function	Oxidoreductase activity, acting on the CH-CH group of donors	IEA
GO:0050660	Function	Flavin adenine dinucleotide binding	IEA

MIM	HGNC	e!Ensembl
604773	87	ENSG00000151498

Q9UKU7

Protein name

Isobutyryl-CoA dehydrogenase, mitochondrial (IBDH) (EC 1.3.8.5) (Activator-recruited cofactor 42 kDa component) (ARC42) (Acyl-CoA dehydrogenase family member 8) (ACAD-8)

Protein function

Isobutyryl-CoA dehydrogenase which catalyzes the conversion of 2-methylpropanoyl-CoA to (2E)-2-methylpropenoyl-CoA in the valine catabolic pathway (PubMed:11013134, PubMed:12359132, PubMed:16857760). To a lesser extent, also able to catalyze the

PDB

1RX0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02771	Acyl-CoA_dh_N	42 → 153	Acyl-CoA dehydrogenase, N-terminal domain	Domain
PF02770	Acyl-CoA_dh_M	157 → 251	Acyl-CoA dehydrogenase, middle domain	Domain
PF00441	Acyl-CoA_dh_1	263 → 413	Acyl-CoA dehydrogenase, C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected at comparable levels in heart, lung, brain, skeletal muscle, pancreas and placenta. Weakly expressed in liver and kidney. {ECO:0000269|PubMed:10524212}.

Sequence

MLWSGCRRFGARLGCLPGGLRVLVQTGHRSLTSCIDPSMGLNEEQKEFQKVAFDFAAREM
APNMAEWDQKELFPVDVMRKAAQLGFGGVYIQTDVGGSGLSRLDTSVIFEALATGCTSTT
AYISIHNMCAWMIDSFGNEEQRHKFCPPLCTMEKFASYCLTEPGSGSDAASLLTSAKKQG
DHYILNGSKAFISGAGESDIYVVMCRTGGPGPKGISCIVVEKGTPGLSFGKKEKKVGWNS
QPTRAVIFEDCAVPVANRIGSEGQGFLIAVRGLNGGRINIASCSLGAAHASVILTRDHLN
VRKQFGEPLASNQYLQFTLADMATRLVAARLMVRNAAVALQEERKDAVALCSMAKLFATD
ECFAICNQALQMHGGYGYLKDYAVQQYVRDSRVHQILEGSNEVMRILISRSLLQE

Sequence length

415

Interactions

View interactions

	KEGG		Reactome
	Valine, leucine and isoleucine degradation Metabolic pathways		Branched-chain amino acid catabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
ACAD8-related disorder	Pathogenic; Likely pathogenic	rs572619478, rs934865815	RCV004749810 RCV003399635	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Deficiency of isobutyryl-CoA dehydrogenase	Likely pathogenic; Pathogenic	rs374317179, rs572619478, rs773472208, rs770663870, rs1207482914, rs121908419, rs121908421, rs751940610, rs369445365, rs1339547372, rs759600553, rs757899755, rs779385985, rs763520594, rs537831211 View all (6 more)	RCV001040333 RCV001381283 RCV002037738 RCV002000040 RCV002040147 View all (17 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (121)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
3-Hydroxy-3-Methylglutaryl-CoA Synthase 2 Deficiency	3-hydroxy-3-methylglutaryl-CoA synthase deficiency	BEFREE	25111118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28174420, 29498404		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha 1-Antitrypsin Deficiency	Alpha 1-Antitrypsin Deficiency	BEFREE	9489912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17387528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anal canal squamous cell carcinoma	Anal Canal carcinoma	BEFREE	28379306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	27885843, 28575481, 29358946, 29955835, 30544202, 31665264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	29470284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	29637483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28867427, 29048552, 30635487, 30722006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28867427, 29048552, 30635487, 30722006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	11488108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	26992953, 28701106, 7567186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	25908719, 28572722, 31424717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	BEFREE	29741671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25895113, 30971755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	16205737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16230082, 20176035, 21519361, 27473029, 28293027, 30304371, 30517639, 30535144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	28293027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16169781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28453767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	21770680, 22342295, 29741603, 29741671, 29973676, 30014225, 30304371, 30565165, 7813110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Diabetes Insipidus	Diabetes Insipidus	BEFREE	23848254, 29084081, 29528385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28293027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	BEFREE	29316057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	29360496, 31840738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic granulomatous disease	Granulomatous Disease	BEFREE	27861181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	20864658, 21102504, 21304479, 21519361, 22410118, 25795566, 26801887, 27371534, 27995656, 28389570, 28468761, 28743984, 28967957, 29136128, 29648663 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis, Collagenous	Colitis	BEFREE	30696605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27915988, 29420429, 30563755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14760767, 17531545, 19404270, 21801808, 23745025, 25838550, 26603485, 27926694, 27995656, 28028930, 28174420, 28337900, 29648663, 29720408, 29950348 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	28369422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	12077086, 12122744, 12664590, 14555911, 15256831, 15290909, 16441470, 16679026, 16987083, 17345609, 18162085, 18521914, 18798573, 19184348, 19436278 View all (106 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deficiency of butyryl-CoA dehydrogenase	Deficiency Of Butyryl-CoA Dehydrogenase	BEFREE	25111118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Diseases	Dental Diseases	BEFREE	29721012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27516406, 28867427, 30256923, 30337374, 30635487, 30982700, 31568153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28160009, 28339674, 29266283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	9133558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	21508504, 29420429, 29878952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysequilibrium syndrome	Dysequilibrium Syndrome	BEFREE	8809232		★★★★★ ★☆☆☆☆ Found in Text Mining only
EHLERS-DANLOS SYNDROME, KYPHOSCOLIOTIC TYPE, 2	Kyphoscoliotic Ehlers-Danlos Syndrome	BEFREE	25111118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enterocolitis	Enterocolitis	BEFREE	30137280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enthesitis	Enthesitis	BEFREE	29741671, 30204909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	30923072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythema Nodosum	Erythema nodosum	BEFREE	22445837		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP C	Fanconi Anemia	BEFREE	29360496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Functional Gastrointestinal Disorders	Functional Gastrointestinal Disorders	BEFREE	31680990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	29321166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	28844092, 29626275, 9229572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	28932959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gluten intolerance	Gluten intolerance	BEFREE	21770680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	17573793, 27466172, 31221086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoids	BEFREE	31580261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	27793450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	31850811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31833544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11438501, 11709510, 12077086, 12664590, 15472510, 15588801, 16679026, 17075348, 17573793, 17786191, 18088053, 18162085, 18341487, 18698678, 19230854 View all (225 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	29265641, 30204909, 30312386, 30545246, 31810607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	21770680, 27885843, 27932449, 31665264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	17573793, 18088053, 23066308, 26660940, 26848182, 27302972, 27926694, 27942974, 27997070, 28050782, 28333341, 28453767, 28509590, 29317064, 29901820 View all (9 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	30614852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	CLINGEN_DG	12359132, 15505379, 16857760, 17304052, 21659959, 24635911, 28053874, 30253142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	UNIPROT_DG	12359132, 15505379, 16857760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	CLINVAR_DG	16857760, 17304052, 25689098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	BEFREE	17924841, 25111118, 30253142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	ORPHANET_DG	24635911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Isobutyryl-CoA dehydrogenase deficiency	Isobutyryl-CoA Dehydrogenase Deficiency	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	29950172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kohlschutter Tonz syndrome	Kohlschutter syndrome	BEFREE	25111118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	15014432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	27558924, 31342537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	29635312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Syndrome, X-Linked, 2	Lymphoproliferative Disorder	BEFREE	31232887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	21770680, 28192499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16169781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22488912, 28453767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28453767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21912466, 22410118, 23347191, 25569743, 28077799, 28158624, 28333358, 28369422, 28389570, 28453756, 29147110, 29420429, 29844587, 30597029, 30874294, 30971761, 31056693, 31318768 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27915988, 29420429, 30563755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	30531816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27516406, 28867427, 30256923, 30337374, 30635487, 30982700, 31568153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30630948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28325746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	28799006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	30722006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27959280, 28160009, 30635487		★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	25702170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17878476, 20208143, 21557394, 23224068, 28115492, 28369329, 29878952, 31175827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	26953272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27899815, 29420429		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteopenia	Osteopenia	BEFREE	29520605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29520605, 31665462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	28379306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29785965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	29785965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	16025115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Perianal abscess	Perianal abscess	BEFREE	30544202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	22405175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior subcapsular cataract	Capsular cataract	BEFREE	29470284, 31056693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	31115454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26887816, 28028930, 28050782, 28293027, 28383652, 28428344, 29180269, 29316057, 29470284, 29852184, 31003979, 31056693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19189980, 22022372, 25234663, 25908719, 28069913, 28160009, 28386763, 28412702, 31079092, 31092171, 31327630, 31424717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Stenosis	Pulmonary Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma Gangrenosum	BEFREE	22445837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	27466171, 28572722, 30635487, 30982700, 31327630		★★★★★ ★☆☆☆☆ Found in Text Mining only
SCLEROSING CHOLANGITIS, NEONATAL	Sclerosing Cholangitis	BEFREE	31770615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	27177777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	28981625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	30721954		★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	25111118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	21640926, 28453761, 28926599, 29741671, 31650573		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21364753		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thrombophilia	Thrombophilia	BEFREE	22405175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	30304371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12077086, 12122744, 14760767, 15256831, 15472510, 16441470, 16679026, 17100976, 17345609, 18598228, 20036705, 21992413, 22022372, 23347191, 23348120 View all (66 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26992953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin D Deficiency	BEFREE	29529167		★★★★★ ★☆☆☆☆ Found in Text Mining only

ACAD8 (acyl-CoA dehydrogenase family member 8)