Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	27013
Gene name	Cyclin Pas1/PHO80 domain containing 1
Gene symbol	CNPPD1
Synonyms (NCBI Gene)	C2orf24CGI-57
Chromosome	2
Chromosome location	2q35

132

Show/Hide all (132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT388973	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT659441	hsa-miR-5700	HITS-CLIP	23824327
MIRT659440	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT659439	hsa-miR-155-5p	HITS-CLIP	23824327
MIRT388973	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT659441	hsa-miR-5700	HITS-CLIP	23824327
MIRT659440	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT659439	hsa-miR-155-5p	HITS-CLIP	23824327
MIRT388973	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT659441	hsa-miR-5700	HITS-CLIP	23824327
MIRT659440	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT659439	hsa-miR-155-5p	HITS-CLIP	23824327
MIRT388973	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT659441	hsa-miR-5700	HITS-CLIP	23824327
MIRT659440	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT659439	hsa-miR-155-5p	HITS-CLIP	23824327
MIRT901223	hsa-miR-1224-3p	CLIP-seq
MIRT901224	hsa-miR-1253	CLIP-seq
MIRT901225	hsa-miR-1260	CLIP-seq
MIRT901226	hsa-miR-1260b	CLIP-seq
MIRT901227	hsa-miR-1273d	CLIP-seq
MIRT901228	hsa-miR-1280	CLIP-seq
MIRT901229	hsa-miR-1286	CLIP-seq
MIRT901230	hsa-miR-150	CLIP-seq
MIRT901231	hsa-miR-155	CLIP-seq
MIRT901232	hsa-miR-1910	CLIP-seq
MIRT901233	hsa-miR-28-5p	CLIP-seq
MIRT901234	hsa-miR-3123	CLIP-seq
MIRT901235	hsa-miR-3139	CLIP-seq
MIRT901236	hsa-miR-3192	CLIP-seq
MIRT901237	hsa-miR-330-3p	CLIP-seq
MIRT901238	hsa-miR-3622a-3p	CLIP-seq
MIRT901239	hsa-miR-3622b-3p	CLIP-seq
MIRT901240	hsa-miR-3677-5p	CLIP-seq
MIRT901241	hsa-miR-4330	CLIP-seq
MIRT901242	hsa-miR-4434	CLIP-seq
MIRT901243	hsa-miR-4435	CLIP-seq
MIRT901244	hsa-miR-4436a	CLIP-seq
MIRT901245	hsa-miR-4516	CLIP-seq
MIRT901246	hsa-miR-4519	CLIP-seq
MIRT901247	hsa-miR-455-3p	CLIP-seq
MIRT901248	hsa-miR-4646-5p	CLIP-seq
MIRT901249	hsa-miR-4707-5p	CLIP-seq
MIRT901250	hsa-miR-4747-5p	CLIP-seq
MIRT901251	hsa-miR-520d-5p	CLIP-seq
MIRT901252	hsa-miR-524-5p	CLIP-seq
MIRT901253	hsa-miR-532-3p	CLIP-seq
MIRT901254	hsa-miR-548a-5p	CLIP-seq
MIRT901255	hsa-miR-548ab	CLIP-seq
MIRT901256	hsa-miR-548ak	CLIP-seq
MIRT901257	hsa-miR-548b-3p	CLIP-seq
MIRT901258	hsa-miR-548b-5p	CLIP-seq
MIRT901259	hsa-miR-548c-5p	CLIP-seq
MIRT901260	hsa-miR-548d-5p	CLIP-seq
MIRT901261	hsa-miR-548h	CLIP-seq
MIRT901262	hsa-miR-548i	CLIP-seq
MIRT901263	hsa-miR-548j	CLIP-seq
MIRT901264	hsa-miR-548n	CLIP-seq
MIRT901265	hsa-miR-548w	CLIP-seq
MIRT901266	hsa-miR-548y	CLIP-seq
MIRT901267	hsa-miR-559	CLIP-seq
MIRT901268	hsa-miR-619	CLIP-seq
MIRT901269	hsa-miR-661	CLIP-seq
MIRT901270	hsa-miR-708	CLIP-seq
MIRT1967363	hsa-miR-1208	CLIP-seq
MIRT1967364	hsa-miR-3194-5p	CLIP-seq
MIRT901237	hsa-miR-330-3p	CLIP-seq
MIRT901240	hsa-miR-3677-5p	CLIP-seq
MIRT1967365	hsa-miR-3926	CLIP-seq
MIRT1967366	hsa-miR-4252	CLIP-seq
MIRT1967367	hsa-miR-4287	CLIP-seq
MIRT1967368	hsa-miR-4292	CLIP-seq
MIRT1967369	hsa-miR-4308	CLIP-seq
MIRT901243	hsa-miR-4435	CLIP-seq
MIRT1967370	hsa-miR-4467	CLIP-seq
MIRT1967371	hsa-miR-4469	CLIP-seq
MIRT901246	hsa-miR-4519	CLIP-seq
MIRT1967372	hsa-miR-452	CLIP-seq
MIRT901248	hsa-miR-4646-5p	CLIP-seq
MIRT1967373	hsa-miR-4676-3p	CLIP-seq
MIRT1967374	hsa-miR-4685-3p	CLIP-seq
MIRT1967375	hsa-miR-4691-3p	CLIP-seq
MIRT1967376	hsa-miR-4738-3p	CLIP-seq
MIRT901250	hsa-miR-4747-5p	CLIP-seq
MIRT901251	hsa-miR-520d-5p	CLIP-seq
MIRT901252	hsa-miR-524-5p	CLIP-seq
MIRT1967377	hsa-miR-548g	CLIP-seq
MIRT1967378	hsa-miR-548s	CLIP-seq
MIRT901269	hsa-miR-661	CLIP-seq
MIRT2203002	hsa-miR-1266	CLIP-seq
MIRT901236	hsa-miR-3192	CLIP-seq
MIRT901240	hsa-miR-3677-5p	CLIP-seq
MIRT2203003	hsa-miR-3913-3p	CLIP-seq
MIRT2203004	hsa-miR-4270	CLIP-seq
MIRT901243	hsa-miR-4435	CLIP-seq
MIRT2203005	hsa-miR-4441	CLIP-seq
MIRT2203006	hsa-miR-4518	CLIP-seq
MIRT901248	hsa-miR-4646-5p	CLIP-seq
MIRT901250	hsa-miR-4747-5p	CLIP-seq
MIRT2203007	hsa-miR-499-3p	CLIP-seq
MIRT2203008	hsa-miR-499a-3p	CLIP-seq
MIRT901269	hsa-miR-661	CLIP-seq
MIRT2505935	hsa-miR-1283	CLIP-seq
MIRT901234	hsa-miR-3123	CLIP-seq
MIRT2505936	hsa-miR-3168	CLIP-seq
MIRT901237	hsa-miR-330-3p	CLIP-seq
MIRT901240	hsa-miR-3677-5p	CLIP-seq
MIRT2505937	hsa-miR-4277	CLIP-seq
MIRT901243	hsa-miR-4435	CLIP-seq
MIRT901246	hsa-miR-4519	CLIP-seq
MIRT1967372	hsa-miR-452	CLIP-seq
MIRT901248	hsa-miR-4646-5p	CLIP-seq
MIRT1967373	hsa-miR-4676-3p	CLIP-seq
MIRT1967376	hsa-miR-4738-3p	CLIP-seq
MIRT901250	hsa-miR-4747-5p	CLIP-seq
MIRT901251	hsa-miR-520d-5p	CLIP-seq
MIRT901252	hsa-miR-524-5p	CLIP-seq
MIRT2505938	hsa-miR-548ac	CLIP-seq
MIRT2505939	hsa-miR-548d-3p	CLIP-seq
MIRT1967377	hsa-miR-548g	CLIP-seq
MIRT2505940	hsa-miR-548z	CLIP-seq
MIRT901269	hsa-miR-661	CLIP-seq
MIRT2505935	hsa-miR-1283	CLIP-seq
MIRT2505936	hsa-miR-3168	CLIP-seq
MIRT2505937	hsa-miR-4277	CLIP-seq
MIRT1967372	hsa-miR-452	CLIP-seq
MIRT1967373	hsa-miR-4676-3p	CLIP-seq
MIRT1967376	hsa-miR-4738-3p	CLIP-seq
MIRT2505938	hsa-miR-548ac	CLIP-seq
MIRT2505939	hsa-miR-548d-3p	CLIP-seq
MIRT1967377	hsa-miR-548g	CLIP-seq
MIRT2505940	hsa-miR-548z	CLIP-seq

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0005634	Component	Nucleus	IBA
GO:0016020	Component	Membrane	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0019901	Function	Protein kinase binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9BV87

Protein name

Protein CNPPD1 (Cyclin Pas1/PHO80 domain-containing protein 1)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08613	Cyclin	72 → 174	Cyclin	Family

Sequence

MDLTGLLLDEEGTFSLAGFQDFTFLPGHQKLSARIRRRLYYGWDWEADCSLEELSSPVAD
IAVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIERLRHRNPDYLQHVSSS
DLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVPTLNALERGFLSAMDWHLYTDPRE
IFEVLSWLESCVAEQQGRWRGWYTYTDLCVLLEQPTWQLALGSLCQRLVKLSCLLAVAYV
SSVALAVASVAVIHQSLGLSCIPTPGPPDLGLTSRCLLEPCIPSVPQCLPSLANVSSCLE
GSMGLRSLWGSLLASLTPPPLPPPDPPAPPTLLHNCHLCQKLQRDSPTCHACLHPNRTVP
TALSSPWYHTYGLAPPWPWSPVLLSLPQPQQCSLFSVMELARLKSFVFPG

Sequence length

410

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (7)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	30670769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35508649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	25944804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	25944804		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30670769	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23474461		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23474461		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

CNPPD1 (cyclin Pas1/PHO80 domain containing 1)