Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	27005
Gene name	Ubiquitin specific peptidase 21
Gene symbol	USP21
Synonyms (NCBI Gene)	USP16USP23
Chromosome	1
Chromosome location	1q23.3
Summary	This gene encodes a member of the C19 peptidase family, also known as family 2 of ubiquitin carboxy-terminal hydrolases. The encoded protein cleaves ubiquitin from ubiquitinated proteins for recycling in intracellular protein degradation. The encoded prot

135

Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028020	hsa-miR-93-5p	Sequencing	20371350
MIRT028308	hsa-miR-32-5p	Sequencing	20371350
MIRT043379	hsa-miR-331-3p	CLASH	23622248
MIRT039291	hsa-miR-671-5p	CLASH	23622248
MIRT037440	hsa-miR-744-5p	CLASH	23622248
MIRT1477945	hsa-miR-1182	CLIP-seq
MIRT1477946	hsa-miR-2467-3p	CLIP-seq
MIRT1477947	hsa-miR-25	CLIP-seq
MIRT1477948	hsa-miR-3145-3p	CLIP-seq
MIRT1477949	hsa-miR-3192	CLIP-seq
MIRT1477950	hsa-miR-32	CLIP-seq
MIRT1477951	hsa-miR-3609	CLIP-seq
MIRT1477952	hsa-miR-363	CLIP-seq
MIRT1477953	hsa-miR-367	CLIP-seq
MIRT1477954	hsa-miR-3675-5p	CLIP-seq
MIRT1477955	hsa-miR-3678-3p	CLIP-seq
MIRT1477956	hsa-miR-3689a-5p	CLIP-seq
MIRT1477957	hsa-miR-3689b	CLIP-seq
MIRT1477958	hsa-miR-3689e	CLIP-seq
MIRT1477959	hsa-miR-3689f	CLIP-seq
MIRT1477960	hsa-miR-4283	CLIP-seq
MIRT1477961	hsa-miR-4489	CLIP-seq
MIRT1477962	hsa-miR-4492	CLIP-seq
MIRT1477963	hsa-miR-4498	CLIP-seq
MIRT1477964	hsa-miR-4505	CLIP-seq
MIRT1477965	hsa-miR-4710	CLIP-seq
MIRT1477966	hsa-miR-4719	CLIP-seq
MIRT1477967	hsa-miR-4792	CLIP-seq
MIRT1477968	hsa-miR-4802-3p	CLIP-seq
MIRT1477969	hsa-miR-513b	CLIP-seq
MIRT1477970	hsa-miR-548ah	CLIP-seq
MIRT1477971	hsa-miR-548t	CLIP-seq
MIRT1477972	hsa-miR-762	CLIP-seq
MIRT1477973	hsa-miR-92a	CLIP-seq
MIRT1477974	hsa-miR-92b	CLIP-seq
MIRT1477975	hsa-let-7a	CLIP-seq
MIRT1477976	hsa-let-7b	CLIP-seq
MIRT1477977	hsa-let-7c	CLIP-seq
MIRT1477978	hsa-let-7d	CLIP-seq
MIRT1477979	hsa-let-7e	CLIP-seq
MIRT1477980	hsa-let-7f	CLIP-seq
MIRT1477981	hsa-let-7g	CLIP-seq
MIRT1477982	hsa-let-7i	CLIP-seq
MIRT1477983	hsa-miR-202	CLIP-seq
MIRT1477947	hsa-miR-25	CLIP-seq
MIRT1477984	hsa-miR-3121-3p	CLIP-seq
MIRT1477948	hsa-miR-3145-3p	CLIP-seq
MIRT1477950	hsa-miR-32	CLIP-seq
MIRT1477951	hsa-miR-3609	CLIP-seq
MIRT1477952	hsa-miR-363	CLIP-seq
MIRT1477953	hsa-miR-367	CLIP-seq
MIRT1477955	hsa-miR-3678-3p	CLIP-seq
MIRT1477956	hsa-miR-3689a-5p	CLIP-seq
MIRT1477957	hsa-miR-3689b	CLIP-seq
MIRT1477958	hsa-miR-3689e	CLIP-seq
MIRT1477959	hsa-miR-3689f	CLIP-seq
MIRT1477985	hsa-miR-3921	CLIP-seq
MIRT1477986	hsa-miR-4458	CLIP-seq
MIRT1477987	hsa-miR-4500	CLIP-seq
MIRT1477988	hsa-miR-4649-3p	CLIP-seq
MIRT1477989	hsa-miR-4653-5p	CLIP-seq
MIRT1477966	hsa-miR-4719	CLIP-seq
MIRT1477990	hsa-miR-513a-3p	CLIP-seq
MIRT1477969	hsa-miR-513b	CLIP-seq
MIRT1477970	hsa-miR-548ah	CLIP-seq
MIRT1477971	hsa-miR-548t	CLIP-seq
MIRT1477991	hsa-miR-553	CLIP-seq
MIRT1477992	hsa-miR-593	CLIP-seq
MIRT1477973	hsa-miR-92a	CLIP-seq
MIRT1477974	hsa-miR-92b	CLIP-seq
MIRT1477993	hsa-miR-939	CLIP-seq
MIRT1477994	hsa-miR-98	CLIP-seq
MIRT1477984	hsa-miR-3121-3p	CLIP-seq
MIRT1477975	hsa-let-7a	CLIP-seq
MIRT1477976	hsa-let-7b	CLIP-seq
MIRT1477977	hsa-let-7c	CLIP-seq
MIRT1477978	hsa-let-7d	CLIP-seq
MIRT1477979	hsa-let-7e	CLIP-seq
MIRT1477980	hsa-let-7f	CLIP-seq
MIRT1477981	hsa-let-7g	CLIP-seq
MIRT1477982	hsa-let-7i	CLIP-seq
MIRT1477945	hsa-miR-1182	CLIP-seq
MIRT2364215	hsa-miR-1207-5p	CLIP-seq
MIRT2364216	hsa-miR-1909	CLIP-seq
MIRT1477983	hsa-miR-202	CLIP-seq
MIRT1477946	hsa-miR-2467-3p	CLIP-seq
MIRT1477947	hsa-miR-25	CLIP-seq
MIRT2364217	hsa-miR-27a	CLIP-seq
MIRT2364218	hsa-miR-27b	CLIP-seq
MIRT1477984	hsa-miR-3121-3p	CLIP-seq
MIRT1477948	hsa-miR-3145-3p	CLIP-seq
MIRT2364219	hsa-miR-3158-3p	CLIP-seq
MIRT1477950	hsa-miR-32	CLIP-seq
MIRT1477951	hsa-miR-3609	CLIP-seq
MIRT1477952	hsa-miR-363	CLIP-seq
MIRT1477953	hsa-miR-367	CLIP-seq
MIRT1477955	hsa-miR-3678-3p	CLIP-seq
MIRT1477956	hsa-miR-3689a-5p	CLIP-seq
MIRT1477957	hsa-miR-3689b	CLIP-seq
MIRT1477958	hsa-miR-3689e	CLIP-seq
MIRT1477959	hsa-miR-3689f	CLIP-seq
MIRT1477985	hsa-miR-3921	CLIP-seq
MIRT1477986	hsa-miR-4458	CLIP-seq
MIRT2364220	hsa-miR-4488	CLIP-seq
MIRT1477987	hsa-miR-4500	CLIP-seq
MIRT1477988	hsa-miR-4649-3p	CLIP-seq
MIRT1477989	hsa-miR-4653-5p	CLIP-seq
MIRT2364221	hsa-miR-4667-5p	CLIP-seq
MIRT2364222	hsa-miR-4675	CLIP-seq
MIRT2364223	hsa-miR-4697-5p	CLIP-seq
MIRT2364224	hsa-miR-4700-5p	CLIP-seq
MIRT1477965	hsa-miR-4710	CLIP-seq
MIRT2364225	hsa-miR-4718	CLIP-seq
MIRT1477966	hsa-miR-4719	CLIP-seq
MIRT2364226	hsa-miR-4741	CLIP-seq
MIRT2364227	hsa-miR-4763-3p	CLIP-seq
MIRT1477967	hsa-miR-4792	CLIP-seq
MIRT1477968	hsa-miR-4802-3p	CLIP-seq
MIRT2364228	hsa-miR-513a-5p	CLIP-seq
MIRT1477969	hsa-miR-513b	CLIP-seq
MIRT1477970	hsa-miR-548ah	CLIP-seq
MIRT1477971	hsa-miR-548t	CLIP-seq
MIRT2364229	hsa-miR-552	CLIP-seq
MIRT1477992	hsa-miR-593	CLIP-seq
MIRT2364230	hsa-miR-609	CLIP-seq
MIRT2364231	hsa-miR-637	CLIP-seq
MIRT2364232	hsa-miR-764	CLIP-seq
MIRT2364233	hsa-miR-877	CLIP-seq
MIRT1477973	hsa-miR-92a	CLIP-seq
MIRT1477974	hsa-miR-92b	CLIP-seq
MIRT1477994	hsa-miR-98	CLIP-seq
MIRT2463023	hsa-miR-4633-3p	CLIP-seq
MIRT2463024	hsa-miR-4640-3p	CLIP-seq
MIRT2463023	hsa-miR-4633-3p	CLIP-seq
MIRT2463024	hsa-miR-4640-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
FOXP3	Activation	23395819

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	10799498, 32011234
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	26100909
GO:0004843	Function	Cysteine-type deubiquitinase activity	ISS
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	19615732, 25416956, 26100909, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IMP	10799498
GO:0008234	Function	Cysteine-type peptidase activity	ISS
GO:0016579	Process	Protein deubiquitination	IDA	32011234
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016787	Function	Hydrolase activity	IEA
GO:0019784	Function	DeNEDDylase activity	IDA	10799498
GO:0032790	Process	Ribosome disassembly	IDA	36302773
GO:0045815	Process	Transcription initiation-coupled chromatin remodeling	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0072344	Process	Rescue of stalled ribosome	IDA	36302773

MIM	HGNC	e!Ensembl
604729	12620	ENSG00000143258

Q9UK80

Protein name

Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.4.19.12) (Deubiquitinating enzyme 21) (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21)

Protein function

Deubiquitinates histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator (By similarity). Deubiquitination of histone H2A releaves the repression of di- and trimethylation of histone H3 at 'Lys-4', r

PDB

2Y5B , 3I3T , 3MTN

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	212 → 555	Ubiquitin carboxyl-terminal hydrolase	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart, pancreas and skeletal muscle. Also expressed in brain, placenta, liver and kidney, and at very low level in lung. {ECO:0000269|PubMed:10799498}.

Sequence

MPQASEHRLGRTREPPVNIQPRVGSKLPFAPRARSKERRNPASGPNPMLRPLPPRPGLPD
ERLKKLELGRGRTSGPRPRGPLRADHGVPLPGSPPPTVALPLPSRTNLARSKSVSSGDLR
PMGIALGGHRGTGELGAALSRLALRPEPPTLRRSTSLRRLGGFPGPPTLFSIRTEPPASH
GSFHMISARSSEPFYSDDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRPLRDFC
LRRDFRQEVPGGGRAQELTEAFADVIGALWHPDSCEAVNPTRFRAVFQKYVPSFSGYSQQ
DAQEFLKLLMERLHLEINRRGRRAPPILANGPVPSPPRRGGALLEEPELSDDDRANLMWK
RYLEREDSKIVDLFVGQLKSCLKCQACGYRSTTFEVFCDLSLPIPKKGFAGGKVSLRDCF
NLFTKEEELESENAPVCDRCRQKTRSTKKLTVQRFPRILVLHLNRFSASRGSIKKSSVGV
DFPLQRLSLGDFASDKAGSPVYQLYALCNHSGSVHYGHYTALCRCQTGWHVYNDSRVSPV
SENQVASSEGYVLFYQLMQEPPRCL

Sequence length

565

Interactions

View interactions

	KEGG		Reactome
	Necroptosis		TNFR1-induced proapoptotic signaling Regulation of TNFR1 signaling TNFR1-induced NFkappaB signaling pathway Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VARIEGATE PORPHYRIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Hemolytic	Hemolytic anemia	Pubtator	26466379	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29179215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31294790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31294790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	24025767, 30504774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	25305019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	26466379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36197973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31135381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27633997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27633997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31294790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31294790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27633997		★★★★★ ★☆☆☆☆ Found in Text Mining only

USP21 (ubiquitin specific peptidase 21)