PABPC1 (poly(A) binding protein cytoplasmic 1)

Gene

• Entrez ID: 26986
• Gene name: Poly(A) binding protein cytoplasmic 1
• Gene symbol: PABPC1
• Synonyms (NCBI Gene): PAB1, PABP, PABP1, PABPC2, PABPL1
• Chromosome: 8
• Chromosome location: 8q22.3
• Summary: This gene encodes a poly(A) binding protein. The protein shuttles between the nucleus and cytoplasm and binds to the 3` poly(A) tail of eukaryotic messenger RNAs via RNA-recognition motifs. The binding of this protein to poly(A) promotes ribosome recruitm

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004993	hsa-miR-125b-5p	Microarray	17891175
MIRT028502	hsa-miR-30a-5p	Proteomics	18668040
MIRT052261	hsa-let-7b-5p	CLASH	23622248
MIRT047745	hsa-miR-10a-5p	CLASH	23622248
MIRT047501	hsa-miR-10b-5p	CLASH	23622248
MIRT047328	hsa-miR-181a-5p	CLASH	23622248
MIRT045519	hsa-miR-149-5p	CLASH	23622248
MIRT042479	hsa-miR-423-3p	CLASH	23622248
MIRT041210	hsa-miR-193b-3p	CLASH	23622248
MIRT040841	hsa-miR-18a-3p	CLASH	23622248
MIRT038147	hsa-miR-423-5p	CLASH	23622248
MIRT037728	hsa-miR-744-5p	CLASH	23622248
MIRT035902	hsa-miR-1295a	CLASH	23622248
MIRT438315	hsa-miR-34c-5p	qRT-PCR, Western blot	26097561
MIRT438315	hsa-miR-34c-5p	qRT-PCR, Western blot	26097561
MIRT723592	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT723591	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT723590	hsa-miR-200b-3p	HITS-CLIP	19536157
MIRT723589	hsa-miR-200c-3p	HITS-CLIP	19536157
MIRT723588	hsa-miR-429	HITS-CLIP	19536157
MIRT723587	hsa-miR-888-3p	HITS-CLIP	19536157
MIRT723586	hsa-miR-4705	HITS-CLIP	19536157
MIRT723585	hsa-miR-617	HITS-CLIP	19536157
MIRT723584	hsa-miR-6505-3p	HITS-CLIP	19536157
MIRT683202	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT683201	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT683200	hsa-miR-4537	HITS-CLIP	23706177
MIRT683199	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT683198	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT683197	hsa-miR-2467-3p	HITS-CLIP	23706177
MIRT683196	hsa-miR-6499-3p	HITS-CLIP	23706177
MIRT683195	hsa-miR-4252	HITS-CLIP	23706177
MIRT683194	hsa-miR-1227-3p	HITS-CLIP	23706177
MIRT042479	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT570565	hsa-miR-4307	PAR-CLIP	20371350
MIRT541157	hsa-miR-3973	PAR-CLIP	20371350
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT541155	hsa-miR-520h	PAR-CLIP	20371350
MIRT541154	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT541153	hsa-miR-8073	PAR-CLIP	20371350
MIRT541152	hsa-miR-8088	PAR-CLIP	20371350
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT542841	hsa-miR-3661	PAR-CLIP	20371350
MIRT542840	hsa-miR-631	PAR-CLIP	20371350
MIRT541148	hsa-miR-1256	PAR-CLIP	20371350
MIRT542839	hsa-miR-3684	PAR-CLIP	20371350
MIRT570564	hsa-miR-449c-3p	PAR-CLIP	20371350
MIRT042479	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT570565	hsa-miR-4307	PAR-CLIP	20371350
MIRT541157	hsa-miR-3973	PAR-CLIP	20371350
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT541155	hsa-miR-520h	PAR-CLIP	20371350
MIRT541154	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT541153	hsa-miR-8073	PAR-CLIP	20371350
MIRT541152	hsa-miR-8088	PAR-CLIP	20371350
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT542841	hsa-miR-3661	PAR-CLIP	20371350
MIRT542840	hsa-miR-631	PAR-CLIP	20371350
MIRT541148	hsa-miR-1256	PAR-CLIP	20371350
MIRT542839	hsa-miR-3684	PAR-CLIP	20371350
MIRT570564	hsa-miR-449c-3p	PAR-CLIP	20371350
MIRT042479	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT541158	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT541157	hsa-miR-3973	PAR-CLIP	21572407
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT541155	hsa-miR-520h	PAR-CLIP	21572407
MIRT541154	hsa-miR-221-5p	PAR-CLIP	21572407
MIRT541153	hsa-miR-8073	PAR-CLIP	21572407
MIRT541152	hsa-miR-8088	PAR-CLIP	21572407
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	21572407
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	21572407
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	21572407
MIRT542842	hsa-miR-3124-3p	PAR-CLIP	21572407
MIRT542841	hsa-miR-3661	PAR-CLIP	21572407
MIRT542840	hsa-miR-631	PAR-CLIP	21572407
MIRT541148	hsa-miR-1256	PAR-CLIP	21572407
MIRT542839	hsa-miR-3684	PAR-CLIP	21572407
MIRT042479	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT541158	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT541157	hsa-miR-3973	PAR-CLIP	21572407
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT541155	hsa-miR-520h	PAR-CLIP	21572407
MIRT541154	hsa-miR-221-5p	PAR-CLIP	21572407
MIRT541153	hsa-miR-8073	PAR-CLIP	21572407
MIRT541152	hsa-miR-8088	PAR-CLIP	21572407
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	21572407
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	21572407
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	21572407
MIRT541148	hsa-miR-1256	PAR-CLIP	21572407
MIRT541148	hsa-miR-1256	PAR-CLIP	26701625
MIRT541148	hsa-miR-1256	PAR-CLIP	26701625
MIRT541148	hsa-miR-1256	PAR-CLIP	26701625
MIRT541154	hsa-miR-221-5p	PAR-CLIP	26701625
MIRT541154	hsa-miR-221-5p	PAR-CLIP	26701625
MIRT541154	hsa-miR-221-5p	PAR-CLIP	26701625
MIRT542842	hsa-miR-3124-3p	PAR-CLIP	26701625
MIRT541157	hsa-miR-3973	PAR-CLIP	26701625
MIRT541157	hsa-miR-3973	PAR-CLIP	26701625
MIRT541157	hsa-miR-3973	PAR-CLIP	26701625
MIRT042479	hsa-miR-423-3p	PAR-CLIP	26701625
MIRT042479	hsa-miR-423-3p	PAR-CLIP	26701625
MIRT042479	hsa-miR-423-3p	PAR-CLIP	26701625
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	26701625
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	26701625
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	26701625
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	26701625
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	26701625
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	26701625
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	26701625
MIRT541155	hsa-miR-520h	PAR-CLIP	26701625
MIRT541155	hsa-miR-520h	PAR-CLIP	26701625
MIRT541155	hsa-miR-520h	PAR-CLIP	26701625
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	26701625
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	26701625
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	26701625
MIRT541158	hsa-miR-561-3p	PAR-CLIP	26701625
MIRT541158	hsa-miR-561-3p	PAR-CLIP	26701625
MIRT541158	hsa-miR-561-3p	PAR-CLIP	26701625
MIRT541153	hsa-miR-8073	PAR-CLIP	26701625
MIRT541153	hsa-miR-8073	PAR-CLIP	26701625
MIRT541153	hsa-miR-8073	PAR-CLIP	26701625
MIRT541152	hsa-miR-8088	PAR-CLIP	26701625
MIRT541152	hsa-miR-8088	PAR-CLIP	26701625
MIRT541152	hsa-miR-8088	PAR-CLIP	26701625
MIRT723592	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT723591	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT723590	hsa-miR-200b-3p	HITS-CLIP	19536157
MIRT723589	hsa-miR-200c-3p	HITS-CLIP	19536157
MIRT723588	hsa-miR-429	HITS-CLIP	19536157
MIRT723587	hsa-miR-888-3p	HITS-CLIP	19536157
MIRT723586	hsa-miR-4705	HITS-CLIP	19536157
MIRT723585	hsa-miR-617	HITS-CLIP	19536157
MIRT723584	hsa-miR-6505-3p	HITS-CLIP	19536157
MIRT683202	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT683201	hsa-miR-17-3p	HITS-CLIP	23706177
MIRT683200	hsa-miR-4537	HITS-CLIP	23706177
MIRT683199	hsa-miR-485-5p	HITS-CLIP	23706177
MIRT683198	hsa-miR-6884-5p	HITS-CLIP	23706177
MIRT683197	hsa-miR-2467-3p	HITS-CLIP	23706177
MIRT683196	hsa-miR-6499-3p	HITS-CLIP	23706177
MIRT683195	hsa-miR-4252	HITS-CLIP	23706177
MIRT683194	hsa-miR-1227-3p	HITS-CLIP	23706177
MIRT042479	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT570565	hsa-miR-4307	PAR-CLIP	20371350
MIRT541157	hsa-miR-3973	PAR-CLIP	20371350
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT541155	hsa-miR-520h	PAR-CLIP	20371350
MIRT541154	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT541153	hsa-miR-8073	PAR-CLIP	20371350
MIRT541152	hsa-miR-8088	PAR-CLIP	20371350
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT542841	hsa-miR-3661	PAR-CLIP	20371350
MIRT542840	hsa-miR-631	PAR-CLIP	20371350
MIRT541148	hsa-miR-1256	PAR-CLIP	20371350
MIRT542839	hsa-miR-3684	PAR-CLIP	20371350
MIRT570564	hsa-miR-449c-3p	PAR-CLIP	20371350
MIRT042479	hsa-miR-423-3p	PAR-CLIP	20371350
MIRT570565	hsa-miR-4307	PAR-CLIP	20371350
MIRT541157	hsa-miR-3973	PAR-CLIP	20371350
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT541155	hsa-miR-520h	PAR-CLIP	20371350
MIRT541154	hsa-miR-221-5p	PAR-CLIP	20371350
MIRT541153	hsa-miR-8073	PAR-CLIP	20371350
MIRT541152	hsa-miR-8088	PAR-CLIP	20371350
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	20371350
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	20371350
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	20371350
MIRT542841	hsa-miR-3661	PAR-CLIP	20371350
MIRT542840	hsa-miR-631	PAR-CLIP	20371350
MIRT541148	hsa-miR-1256	PAR-CLIP	20371350
MIRT542839	hsa-miR-3684	PAR-CLIP	20371350
MIRT570564	hsa-miR-449c-3p	PAR-CLIP	20371350
MIRT042479	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT541158	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT541157	hsa-miR-3973	PAR-CLIP	21572407
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT541155	hsa-miR-520h	PAR-CLIP	21572407
MIRT541154	hsa-miR-221-5p	PAR-CLIP	21572407
MIRT541153	hsa-miR-8073	PAR-CLIP	21572407
MIRT541152	hsa-miR-8088	PAR-CLIP	21572407
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	21572407
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	21572407
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	21572407
MIRT542842	hsa-miR-3124-3p	PAR-CLIP	21572407
MIRT542841	hsa-miR-3661	PAR-CLIP	21572407
MIRT542840	hsa-miR-631	PAR-CLIP	21572407
MIRT541148	hsa-miR-1256	PAR-CLIP	21572407
MIRT542839	hsa-miR-3684	PAR-CLIP	21572407
MIRT042479	hsa-miR-423-3p	PAR-CLIP	21572407
MIRT541158	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT541157	hsa-miR-3973	PAR-CLIP	21572407
MIRT541156	hsa-miR-520g-3p	PAR-CLIP	21572407
MIRT541155	hsa-miR-520h	PAR-CLIP	21572407
MIRT541154	hsa-miR-221-5p	PAR-CLIP	21572407
MIRT541153	hsa-miR-8073	PAR-CLIP	21572407
MIRT541152	hsa-miR-8088	PAR-CLIP	21572407
MIRT541150	hsa-miR-4720-5p	PAR-CLIP	21572407
MIRT541151	hsa-miR-4799-3p	PAR-CLIP	21572407
MIRT541149	hsa-miR-5588-5p	PAR-CLIP	21572407
MIRT541148	hsa-miR-1256	PAR-CLIP	21572407
MIRT1209397	hsa-miR-1179	CLIP-seq
MIRT1209398	hsa-miR-1182	CLIP-seq
MIRT1209399	hsa-miR-125a-5p	CLIP-seq
MIRT1209400	hsa-miR-125b	CLIP-seq
MIRT1209401	hsa-miR-129-5p	CLIP-seq
MIRT1209402	hsa-miR-186	CLIP-seq
MIRT1209403	hsa-miR-1915	CLIP-seq
MIRT1209404	hsa-miR-2113	CLIP-seq
MIRT1209405	hsa-miR-3117-3p	CLIP-seq
MIRT1209406	hsa-miR-3133	CLIP-seq
MIRT1209407	hsa-miR-3145-3p	CLIP-seq
MIRT1209408	hsa-miR-3163	CLIP-seq
MIRT1209409	hsa-miR-3169	CLIP-seq
MIRT1209410	hsa-miR-3647-3p	CLIP-seq
MIRT1209411	hsa-miR-3692	CLIP-seq
MIRT1209412	hsa-miR-4281	CLIP-seq
MIRT1209413	hsa-miR-4319	CLIP-seq
MIRT1209414	hsa-miR-4446-5p	CLIP-seq
MIRT1209415	hsa-miR-450b-5p	CLIP-seq
MIRT1209416	hsa-miR-4659a-3p	CLIP-seq
MIRT1209417	hsa-miR-4659b-3p	CLIP-seq
MIRT1209418	hsa-miR-4726-3p	CLIP-seq
MIRT1209419	hsa-miR-4732-3p	CLIP-seq
MIRT1209420	hsa-miR-4759	CLIP-seq
MIRT1209421	hsa-miR-4760-5p	CLIP-seq
MIRT1209422	hsa-miR-4775	CLIP-seq
MIRT1209423	hsa-miR-4796-5p	CLIP-seq
MIRT1209424	hsa-miR-507	CLIP-seq
MIRT1209425	hsa-miR-513a-3p	CLIP-seq
MIRT1209426	hsa-miR-520d-5p	CLIP-seq
MIRT1209427	hsa-miR-520g	CLIP-seq
MIRT1209428	hsa-miR-524-5p	CLIP-seq
MIRT1209429	hsa-miR-557	CLIP-seq
MIRT1209430	hsa-miR-561	CLIP-seq
MIRT1209431	hsa-miR-587	CLIP-seq
MIRT1209432	hsa-miR-599	CLIP-seq
MIRT1209433	hsa-miR-628-5p	CLIP-seq
MIRT1209434	hsa-miR-670	CLIP-seq
MIRT1209398	hsa-miR-1182	CLIP-seq
MIRT1209399	hsa-miR-125a-5p	CLIP-seq
MIRT1209400	hsa-miR-125b	CLIP-seq
MIRT1209402	hsa-miR-186	CLIP-seq
MIRT1209403	hsa-miR-1915	CLIP-seq
MIRT1209406	hsa-miR-3133	CLIP-seq
MIRT1209407	hsa-miR-3145-3p	CLIP-seq
MIRT1209408	hsa-miR-3163	CLIP-seq
MIRT1209410	hsa-miR-3647-3p	CLIP-seq
MIRT1209411	hsa-miR-3692	CLIP-seq
MIRT2060109	hsa-miR-374a	CLIP-seq
MIRT2060110	hsa-miR-374b	CLIP-seq
MIRT1209412	hsa-miR-4281	CLIP-seq
MIRT2060111	hsa-miR-4303	CLIP-seq
MIRT1209413	hsa-miR-4319	CLIP-seq
MIRT1209414	hsa-miR-4446-5p	CLIP-seq
MIRT1209416	hsa-miR-4659a-3p	CLIP-seq
MIRT1209417	hsa-miR-4659b-3p	CLIP-seq
MIRT1209418	hsa-miR-4726-3p	CLIP-seq
MIRT1209419	hsa-miR-4732-3p	CLIP-seq
MIRT1209421	hsa-miR-4760-5p	CLIP-seq
MIRT1209422	hsa-miR-4775	CLIP-seq
MIRT1209423	hsa-miR-4796-5p	CLIP-seq
MIRT1209427	hsa-miR-520g	CLIP-seq
MIRT1209430	hsa-miR-561	CLIP-seq
MIRT1209431	hsa-miR-587	CLIP-seq
MIRT2060112	hsa-miR-590-3p	CLIP-seq
MIRT2060113	hsa-miR-610	CLIP-seq
MIRT1209433	hsa-miR-628-5p	CLIP-seq
MIRT1209434	hsa-miR-670	CLIP-seq
MIRT1209398	hsa-miR-1182	CLIP-seq
MIRT1209403	hsa-miR-1915	CLIP-seq
MIRT1209408	hsa-miR-3163	CLIP-seq
MIRT1209410	hsa-miR-3647-3p	CLIP-seq
MIRT1209414	hsa-miR-4446-5p	CLIP-seq
MIRT1209415	hsa-miR-450b-5p	CLIP-seq
MIRT1209418	hsa-miR-4726-3p	CLIP-seq
MIRT1209422	hsa-miR-4775	CLIP-seq
MIRT1209423	hsa-miR-4796-5p	CLIP-seq
MIRT1209424	hsa-miR-507	CLIP-seq
MIRT1209425	hsa-miR-513a-3p	CLIP-seq
MIRT1209427	hsa-miR-520g	CLIP-seq
MIRT1209429	hsa-miR-557	CLIP-seq
MIRT1209430	hsa-miR-561	CLIP-seq
MIRT1209431	hsa-miR-587	CLIP-seq
MIRT1209433	hsa-miR-628-5p	CLIP-seq
MIRT1209410	hsa-miR-3647-3p	CLIP-seq
MIRT1209433	hsa-miR-628-5p	CLIP-seq
MIRT1209397	hsa-miR-1179	CLIP-seq
MIRT1209398	hsa-miR-1182	CLIP-seq
MIRT1209401	hsa-miR-129-5p	CLIP-seq
MIRT1209402	hsa-miR-186	CLIP-seq
MIRT1209403	hsa-miR-1915	CLIP-seq
MIRT1209404	hsa-miR-2113	CLIP-seq
MIRT1209405	hsa-miR-3117-3p	CLIP-seq
MIRT1209406	hsa-miR-3133	CLIP-seq
MIRT1209407	hsa-miR-3145-3p	CLIP-seq
MIRT1209408	hsa-miR-3163	CLIP-seq
MIRT1209409	hsa-miR-3169	CLIP-seq
MIRT1209411	hsa-miR-3692	CLIP-seq
MIRT1209412	hsa-miR-4281	CLIP-seq
MIRT2060111	hsa-miR-4303	CLIP-seq
MIRT1209414	hsa-miR-4446-5p	CLIP-seq
MIRT1209415	hsa-miR-450b-5p	CLIP-seq
MIRT1209416	hsa-miR-4659a-3p	CLIP-seq
MIRT1209417	hsa-miR-4659b-3p	CLIP-seq
MIRT1209418	hsa-miR-4726-3p	CLIP-seq
MIRT1209420	hsa-miR-4759	CLIP-seq
MIRT1209421	hsa-miR-4760-5p	CLIP-seq
MIRT1209422	hsa-miR-4775	CLIP-seq
MIRT1209423	hsa-miR-4796-5p	CLIP-seq
MIRT1209424	hsa-miR-507	CLIP-seq
MIRT1209426	hsa-miR-520d-5p	CLIP-seq
MIRT1209427	hsa-miR-520g	CLIP-seq
MIRT1209428	hsa-miR-524-5p	CLIP-seq
MIRT1209429	hsa-miR-557	CLIP-seq
MIRT1209430	hsa-miR-561	CLIP-seq
MIRT1209431	hsa-miR-587	CLIP-seq
MIRT1209432	hsa-miR-599	CLIP-seq
MIRT2060113	hsa-miR-610	CLIP-seq
MIRT1209402	hsa-miR-186	CLIP-seq
MIRT1209406	hsa-miR-3133	CLIP-seq
MIRT1209411	hsa-miR-3692	CLIP-seq
MIRT2060111	hsa-miR-4303	CLIP-seq
MIRT2060113	hsa-miR-610	CLIP-seq
MIRT1209398	hsa-miR-1182	CLIP-seq
MIRT1209402	hsa-miR-186	CLIP-seq
MIRT1209403	hsa-miR-1915	CLIP-seq
MIRT1209406	hsa-miR-3133	CLIP-seq
MIRT1209408	hsa-miR-3163	CLIP-seq
MIRT1209410	hsa-miR-3647-3p	CLIP-seq
MIRT1209411	hsa-miR-3692	CLIP-seq
MIRT2060111	hsa-miR-4303	CLIP-seq
MIRT1209414	hsa-miR-4446-5p	CLIP-seq
MIRT1209418	hsa-miR-4726-3p	CLIP-seq
MIRT1209422	hsa-miR-4775	CLIP-seq
MIRT1209423	hsa-miR-4796-5p	CLIP-seq
MIRT1209425	hsa-miR-513a-3p	CLIP-seq
MIRT1209426	hsa-miR-520d-5p	CLIP-seq
MIRT1209428	hsa-miR-524-5p	CLIP-seq
MIRT2060113	hsa-miR-610	CLIP-seq
MIRT1209433	hsa-miR-628-5p	CLIP-seq
MIRT1209398	hsa-miR-1182	CLIP-seq
MIRT1209402	hsa-miR-186	CLIP-seq
MIRT1209403	hsa-miR-1915	CLIP-seq
MIRT1209406	hsa-miR-3133	CLIP-seq
MIRT1209408	hsa-miR-3163	CLIP-seq
MIRT1209410	hsa-miR-3647-3p	CLIP-seq
MIRT1209411	hsa-miR-3692	CLIP-seq
MIRT2060111	hsa-miR-4303	CLIP-seq
MIRT1209414	hsa-miR-4446-5p	CLIP-seq
MIRT1209418	hsa-miR-4726-3p	CLIP-seq
MIRT1209422	hsa-miR-4775	CLIP-seq
MIRT1209423	hsa-miR-4796-5p	CLIP-seq
MIRT1209425	hsa-miR-513a-3p	CLIP-seq
MIRT1209426	hsa-miR-520d-5p	CLIP-seq
MIRT1209428	hsa-miR-524-5p	CLIP-seq
MIRT2060113	hsa-miR-610	CLIP-seq
MIRT1209433	hsa-miR-628-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000184	Process	Nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	25225333
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IPI	23041282
GO:0003729	Function	MRNA binding	EXP	23041282
GO:0003730	Function	MRNA 3'-UTR binding	IBA
GO:0003730	Function	MRNA 3'-UTR binding	IDA	16126846
GO:0005515	Function	Protein binding	IPI	11051545, 11172725, 11997512, 12086624, 12489690, 14685257, 15567442, 15663938, 16452507, 16556936, 16601676, 16772376, 16804161, 17289661, 17392519, 17595167, 17932509, 18256688, 18447585, 18596238, 19515850, 19716330, 20098421, 20181956, 20221403, 20418951, 20430826, 20595389, 205
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	21940797
GO:0005634	Component	Nucleus	IEA
GO:0005681	Component	Spliceosomal complex	IEA
GO:0005737	Component	Cytoplasm	IDA	28733330
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9582337
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	11051545
GO:0005829	Component	Cytosol	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0006397	Process	MRNA processing	IEA
GO:0008143	Function	Poly(A) binding	IBA
GO:0008143	Function	Poly(A) binding	IDA	16804161, 21984414
GO:0008143	Function	Poly(A) binding	IEA
GO:0008143	Function	Poly(A) binding	TAS	2885805
GO:0008266	Function	Poly(U) RNA binding	IBA
GO:0008266	Function	Poly(U) RNA binding	IDA	21984414
GO:0008380	Process	RNA splicing	IEA
GO:0008494	Function	Translation activator activity	TAS	11997512
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:0010494	Component	Cytoplasmic stress granule	IDA	21883093, 21940797
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0030027	Component	Lamellipodium	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	ISS
GO:0031252	Component	Cell leading edge	IDA	28733330
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042995	Component	Cell projection	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IMP	26735137
GO:0048255	Process	MRNA stabilization	TAS	11997512
GO:0060213	Process	Positive regulation of nuclear-transcribed mRNA poly(A) tail shortening	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0070934	Process	CRD-mediated mRNA stabilization	IDA	11051545
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:0106002	Component	MCRD-mediated mRNA stability complex	IPI	11051545
GO:1900152	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	IDA	11051545
GO:1900153	Process	Positive regulation of nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay	ISS
GO:1990904	Component	Ribonucleoprotein complex	IBA
GO:1990904	Component	Ribonucleoprotein complex	IDA	17289661
GO:2000623	Process	Negative regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IDA	18447585
GO:2000767	Process	Positive regulation of cytoplasmic translation	IDA	11051545

Other IDs

• MIM: 604679
• HGNC: 8554
• e!Ensembl: ENSG00000070756

Protein

• UniProt ID: P11940
• Protein name: Polyadenylate-binding protein 1 (PABP-1) (Poly(A)-binding protein 1)
• Protein function: Binds the poly(A) tail of mRNA, including that of its own transcript, and regulates processes of mRNA metabolism such as pre-mRNA splicing and mRNA stability (PubMed:11051545, PubMed:17212783, PubMed:25480299). Its function in translational init
• PDB: 1CVJ, 1G9L, 1JGN, 1JH4, 2K8G, 2RQG, 2RQH, 2X04, 3KTP, 3KTR, 3KUI, 3KUJ, 3KUR, 3KUS, 3KUT, 3PKN, 3PTH, 4F02, 4F25, 4F26, 5DX1, 5DX8, 5DXA, 5LGP, 5LGQ, 5LGR, 5LGS, 7BN3, 8SMO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00076	RRM_1	13 → 83	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	101 → 168	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	193 → 262	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00076	RRM_1	296 → 364	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
  PF00658	PABP	547 → 614	Poly-adenylate binding protein, unique domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous.
• Sequence:

  MNPSAPSYPMASLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQ
  QPADAERALDTMNFDVIKGKPVRIMWSQRDPSLRKSGVGNIFIKNLDKSIDNKALYDTFS
  AFGNILSCKVVCDENGSKGYGFVHFETQEAAERAIEKMNGMLLNDRKVFVGRFKSRKERE
  AELGARAKEFTNVYIKNFGEDMDDERLKDLFGKFGPALSVKVMTDESGKSKGFGFVSFER
  HEDAQKAVDEMNGKELNGKQIYVGRAQKKVERQTELKRKFEQMKQDRITRYQGVNLYVKN
  LDDGIDDERLRKEFSPFGTITSAKVMMEGGRSKGFGFVCFSSPEEATKAVTEMNGRIVAT
  KPLYVALAQRKEERQAHLTNQYMQRMASVRAVPNPVINPYQPAPPSGYFMAAIPQTQNRA
  AYYPPSQIAQLRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPASSQVPRVMSTQ
  RVANTSTQTMGPRPAAAAAAATPAVRTVPQYKYAAGVRNPQQHLNAQPQVTMQQPAVHVQ
  GQEPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEIDNSELLHMLESP
  ESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV

• Sequence length: 636

Pathways

KEGG:

mRNA surveillance pathway
RNA degradation

Reactome:

L13a-mediated translational silencing of Ceruloplasmin expression
Deadenylation of mRNA
AUF1 (hnRNP D0) binds and destabilizes mRNA
Translation initiation complex formation
Nonsense Mediated Decay (NMD) independent of the Exon Junction Complex (EJC)
Nonsense Mediated Decay (NMD) enhanced by the Exon Junction Complex (EJC)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Pulmonary artery atresia	Pathogenic	rs80006036	RCV002512182	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIC-rearranged sarcoma	not provided	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ATRESIA OF PULMONARY ARTERY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Teratoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	40653482	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	25111021		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	25111021	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	37311641	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	26843391	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	25783786		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	1346789		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	21466612		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26097561	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33080414	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17290396		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36229065	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30867782		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37296477	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20009508	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31847264		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	16465428		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	16465428		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	16465428		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35346324	Associate	★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30541862		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24465609		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24465609		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31797689	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31743794		★☆☆☆☆ Found in Text Mining only
Inclusion Body Myositis (disorder)	Inclusion Body Myositis	BEFREE	16087907		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29991691	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17786358, 26188282, 30655779		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	21466612		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	16465428		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17290396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	26176602, 8105108		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	25783786		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	21466612		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	21466612		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	21466612		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	LHGDN	18642007		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29269946		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	23793615		★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	19605641	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	36803974	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	37058032	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21672358		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29016861, 30610890		★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	26843391		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	26843391		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36614257	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	37506150	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	26176602, 8105108		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26176602, 32800727, 36095024, 37956771	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	39969348	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	25111021	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16465428		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26097561		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26097561, 36112850	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34420428, 37225681	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	26843391	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21672358	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33470388, 36436682	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations