Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2695
Gene name	Gastric inhibitory polypeptide
Gene symbol	GIP
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q21.32
Summary	This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nu

Show/Hide all (10)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018333	hsa-miR-335-5p	Microarray	18185580
MIRT021426	hsa-miR-9-5p	Microarray	17612493
MIRT1019349	hsa-miR-1299	CLIP-seq
MIRT1019350	hsa-miR-2117	CLIP-seq
MIRT1019351	hsa-miR-3940-5p	CLIP-seq
MIRT1019352	hsa-miR-4507	CLIP-seq
MIRT1019353	hsa-miR-4753-3p	CLIP-seq
MIRT1019354	hsa-miR-4778-5p	CLIP-seq
MIRT1019355	hsa-miR-4782-5p	CLIP-seq
MIRT1019356	hsa-miR-516b	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005179	Function	Hormone activity	IEA
GO:0005179	Function	Hormone activity	TAS	2890159
GO:0005515	Function	Protein binding	IPI	17715056, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005788	Component	Endoplasmic reticulum lumen	TAS
GO:0007165	Process	Signal transduction	TAS	2890159
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	26572091
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007613	Process	Memory	IEA
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0031767	Function	Gastric inhibitory polypeptide receptor binding	IPI	17715056, 26572091
GO:0031769	Function	Glucagon receptor binding	IBA
GO:0032024	Process	Positive regulation of insulin secretion	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035640	Process	Exploration behavior	IEA
GO:0038192	Process	Gastric inhibitory peptide signaling pathway	IDA	26572091
GO:0042304	Process	Regulation of fatty acid biosynthetic process	IEA
GO:0042594	Process	Response to starvation	IBA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0050796	Process	Regulation of insulin secretion	TAS	20081857

MIM	HGNC	e!Ensembl
137240	4270	ENSG00000159224

P09681

Protein name

Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) (Incretin hormone)

Protein function

Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion.

PDB

1T5Q , 2B4N , 2L70 , 2L71 , 2OBU , 2QKH , 7DTY , 7RA3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00123	Hormone_2	52 → 79	Peptide hormone	Family

Sequence

MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISD
YSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQREARALELASQANRKEEEAVEPQSSPA
KNPSDEDLLRDLLIQELLACLLDQTNLCRLRSR

Sequence length

153

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Insulin secretion		Synthesis, secretion, and inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP) G alpha (s) signalling events Glucagon-type ligand receptors ADORA2B mediated anti-inflammatory cytokines production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (13)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

GIP (gastric inhibitory polypeptide)