Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2693
Gene name	Growth hormone secretagogue receptor
Gene symbol	GHSR
Synonyms (NCBI Gene)	GHDPGHS-R1aGHSR-1a
Chromosome	3
Chromosome location	3q26.31
Summary	This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserve

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121917883	G>A,T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs267606843	C>G,T	Pathogenic	Coding sequence variant, stop gained, missense variant
rs762351324	T>-	Likely-pathogenic	Frameshift variant, coding sequence variant

Show/Hide all (40)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029715	hsa-miR-26b-5p	Microarray	19088304
MIRT044459	hsa-miR-320a	CLASH	23622248
MIRT532321	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT532320	hsa-miR-889-3p	PAR-CLIP	22012620
MIRT532319	hsa-miR-488-3p	PAR-CLIP	22012620
MIRT532318	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT532321	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT532320	hsa-miR-889-3p	PAR-CLIP	22012620
MIRT532319	hsa-miR-488-3p	PAR-CLIP	22012620
MIRT532318	hsa-miR-510-3p	PAR-CLIP	22012620
MIRT1018519	hsa-miR-1178	CLIP-seq
MIRT1018520	hsa-miR-1197	CLIP-seq
MIRT1018521	hsa-miR-1226	CLIP-seq
MIRT1018522	hsa-miR-1228	CLIP-seq
MIRT1018523	hsa-miR-1270	CLIP-seq
MIRT1018524	hsa-miR-3065-3p	CLIP-seq
MIRT1018525	hsa-miR-342-3p	CLIP-seq
MIRT1018526	hsa-miR-3671	CLIP-seq
MIRT1018527	hsa-miR-4436a	CLIP-seq
MIRT1018528	hsa-miR-4531	CLIP-seq
MIRT1018529	hsa-miR-4687-5p	CLIP-seq
MIRT1018530	hsa-miR-4700-3p	CLIP-seq
MIRT1018531	hsa-miR-4733-3p	CLIP-seq
MIRT1018532	hsa-miR-4735-5p	CLIP-seq
MIRT1018533	hsa-miR-4762-5p	CLIP-seq
MIRT1018534	hsa-miR-518a-5p	CLIP-seq
MIRT1018535	hsa-miR-527	CLIP-seq
MIRT1018536	hsa-miR-556-3p	CLIP-seq
MIRT1018537	hsa-miR-570	CLIP-seq
MIRT1018538	hsa-miR-620	CLIP-seq
MIRT1018539	hsa-miR-634	CLIP-seq
MIRT1018540	hsa-miR-767-3p	CLIP-seq
MIRT2001636	hsa-miR-3646	CLIP-seq
MIRT2001637	hsa-miR-3908	CLIP-seq
MIRT2001638	hsa-miR-4328	CLIP-seq
MIRT2001639	hsa-miR-4476	CLIP-seq
MIRT2234707	hsa-miR-4303	CLIP-seq
MIRT2234708	hsa-miR-4427	CLIP-seq
MIRT1018527	hsa-miR-4436a	CLIP-seq
MIRT1018530	hsa-miR-4700-3p	CLIP-seq

Show/Hide all (84)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001616	Function	Growth hormone secretagogue receptor activity	IBA
GO:0001616	Function	Growth hormone secretagogue receptor activity	IDA	8688086
GO:0001616	Function	Growth hormone secretagogue receptor activity	IEA
GO:0002031	Process	G protein-coupled receptor internalization	IDA	10644702
GO:0004930	Function	G protein-coupled receptor activity	IDA	8688086
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	27129257, 29876881
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15232612
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	8688086
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008154	Process	Actin polymerization or depolymerization	IDA	15232612
GO:0008343	Process	Adult feeding behavior	IEA
GO:0008343	Process	Adult feeding behavior	ISS
GO:0009725	Process	Response to hormone	IDA	15232612
GO:0009755	Process	Hormone-mediated signaling pathway	IBA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	31911434
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	8688086
GO:0009986	Component	Cell surface	IDA	8688086
GO:0010700	Process	Negative regulation of norepinephrine secretion	IEA
GO:0016020	Component	Membrane	IEA
GO:0016520	Function	Growth hormone-releasing hormone receptor activity	IDA	8688086
GO:0017046	Function	Peptide hormone binding	IEA
GO:0030072	Process	Peptide hormone secretion	IEA
GO:0030252	Process	Growth hormone secretion	IEA
GO:0030252	Process	Growth hormone secretion	TAS	16511605
GO:0032094	Process	Response to food	IEA
GO:0032099	Process	Negative regulation of appetite	IEA
GO:0032100	Process	Positive regulation of appetite	IEA
GO:0032100	Process	Positive regulation of appetite	ISS
GO:0032354	Process	Response to follicle-stimulating hormone	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0032691	Process	Negative regulation of interleukin-1 beta production	IDA	15232612
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	15232612
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	15232612
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IEA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IEA
GO:0036321	Process	Ghrelin secretion	IEA
GO:0040018	Process	Positive regulation of multicellular organism growth	IMP	16511605
GO:0042562	Function	Hormone binding	IEA
GO:0042802	Function	Identical protein binding	IPI	27129257, 29876881
GO:0043005	Component	Neuron projection	IDA	12890514
GO:0043134	Process	Regulation of hindgut contraction	IEA
GO:0043568	Process	Positive regulation of insulin-like growth factor receptor signaling pathway	IEA
GO:0045121	Component	Membrane raft	IDA	15232612
GO:0045923	Process	Positive regulation of fatty acid metabolic process	IEA
GO:0045927	Process	Positive regulation of growth	IEA
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046697	Process	Decidualization	IDA	17494105
GO:0048009	Process	Insulin-like growth factor receptor signaling pathway	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IDA	15232612
GO:0051963	Process	Regulation of synapse assembly	IEA
GO:0051969	Process	Regulation of transmission of nerve impulse	IEA
GO:0060123	Process	Regulation of growth hormone secretion	IEA
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060416	Process	Response to growth hormone	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0090327	Process	Negative regulation of locomotion involved in locomotory behavior	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0097067	Process	Cellular response to thyroid hormone stimulus	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098696	Process	Regulation of neurotransmitter receptor localization to postsynaptic specialization membrane	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:0099175	Process	Regulation of postsynapse organization	IEA
GO:0120058	Process	Positive regulation of small intestinal transit	IEA
GO:1902065	Process	Response to L-glutamate	IEA
GO:1903672	Process	Positive regulation of sprouting angiogenesis	IEA
GO:1904000	Process	Positive regulation of eating behavior	IEA
GO:1904349	Process	Positive regulation of small intestine smooth muscle contraction	IEA
GO:1905333	Process	Regulation of gastric motility	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IEA
GO:1990314	Process	Cellular response to insulin-like growth factor stimulus	IEA
GO:2000110	Process	Negative regulation of macrophage apoptotic process	IEA

MIM	HGNC	e!Ensembl
601898	4267	ENSG00000121853

Q92847

Protein name

Growth hormone secretagogue receptor type 1 (GHS-R) (GH-releasing peptide receptor) (GHRP) (Ghrelin receptor)

Protein function

Receptor for ghrelin, coupled to G-alpha-11 proteins. Stimulates growth hormone secretion. Also binds other growth hormone releasing peptides (GHRP) (e.g. Met-enkephalin and GHRP-6) as well as non-peptide, low molecular weight secretagogues (e.g

PDB

6KO5 , 7F9Y , 7F9Z , 7NA7 , 7NA8 , 7W2Z , 8JSR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	60 → 323	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Pituitary and hypothalamus.

Sequence

MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT

Sequence length

366

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Growth hormone synthesis, secretion and action		G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Short stature due to growth hormone secretagogue receptor deficiency	Likely pathogenic; Pathogenic	rs1043529281, rs267606843	RCV001824197 RCV000008072	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIGESTIVE SYSTEM NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GHSR-related disorder	Conflicting classifications of pathogenicity; Benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH HORMONE DEFICIENCY, ISOLATED PARTIAL	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDOHYPOPARATHYROIDISM, TYPE IB	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short stature	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short stature due to partial GHR deficiency	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (142)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ACTH Syndrome, Ectopic	Ectopic ACTH secretion syndrome	BEFREE	18426818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	14616888, 29963901, 9851770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	16020971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	28598597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	16020971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	31421834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	28298897, 29066414, 29914876, 31415709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	16362631, 23601422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	26578081, 30582955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	26578081, 30582955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	16020971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	12056541, 17884032, 19931584, 28598597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28636167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	16527811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	12056541, 17884032, 19931584, 28598597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	21630326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16322325, 21829727, 22899222, 25376984, 25524946, 31638176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18091988, 25557172, 35763463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	31469195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	16362631, 23601422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	15232612	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	CTD_human_DG	18064392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29262839, 31750884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid tumor of lung	Carcinoid Tumor Of Lung	BEFREE	17556872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28719746, 30429981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	18091988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31020605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	31375017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29486584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26879868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20920174, 29963901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20920174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	16549524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20804798, 30282322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25925728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	12056541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	17324965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	18426818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18425803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	18425803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	28542403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	17556872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30738804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30582955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	31578828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28544245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18698404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18698404, 19460888, 19506043, 22441120, 30390290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Digestive System Neoplasms	Digestive System Neoplasms	CTD_human_DG	18064392		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Digestive System Neoplasms	Digestive system neoplasm	Pubtator	18064392	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	BEFREE	16511600, 16511605, 19363508, 21084395, 22876551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	36714562	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	16511605, 19789204, 21646290, 27023906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	16362631, 23652389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	23736537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	21761369	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28544245, 31546643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30677130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	29205695, 29550791, 30199408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	9768675		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	18426818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20804798, 30282322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31063397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20596792, 29923768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	15616037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	29233536, 31520709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	23652389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18425803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19165163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28930716, 31311066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	17114911, 25557026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	15616037, 16567594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	16567594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17018595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16322325, 21829727, 22899222, 25376984, 25524946, 31638176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	23736537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31020605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28851363, 30390209, 31469937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23807739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23652389, 25376984, 25524946, 27552970, 28119363, 28298897, 28621564, 29344250, 30677130, 31746370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26879868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	27552970, 30223587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	21829727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30582955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25036503, 28544245, 30020830, 30265805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	15616037	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	15616037, 19024096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	30582955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motion Sickness	Motion Sickness	BEFREE	31722444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	21664965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	17324965, 27343377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16020971, 17556872, 19707004, 23736537, 28851363, 30390209, 8721987, 9851770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	11158061, 9768675		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	29262839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	29262839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	29262839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23722988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12907757, 15616037, 18698404, 19165163, 20404923, 21345363, 21895961, 22876551, 26255942, 27129673, 27288828, 27320641, 29119689, 29453460, 30020830, 30275401, 31748785 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	15616037, 18647811, 18698404, 19165163, 20404923	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ocular Hypertension	Ocular Hypertension	BEFREE	23816797, 24780389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	31974445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25557172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panhypopituitarism	Panhypopituitarism	BEFREE	25557026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28273852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33260513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	18945286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	29541916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	31038565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	29154935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	29154935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism	Pituitary dwarfism	BEFREE	25557026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30269201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	24735326, 30380028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28851363, 30390209, 31469937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14763915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoparathyroidism	Pseudohypoparathyroidism	Pubtator	40251565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25925728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	24747517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	23816797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	20346234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Short Stature, Idiopathic, Autosomal	Short Stature, Idiopathic, Autosomal	UNIPROT_DG	16511605, 19789204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Short Stature, Idiopathic, Autosomal	Short Stature, Idiopathic, Autosomal	GENOMICS_ENGLAND_DG	19789204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Short Stature, Idiopathic, Autosomal	Short Stature, Idiopathic, Autosomal	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Short Stature, Idiopathic, Autosomal	Short Stature, Idiopathic, Autosomal	ORPHANET_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	17114911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31974445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	28544245, 31546643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23807739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	21274374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	14715878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	31746370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12547722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	12547722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyrotroph adenoma	Adenoma	BEFREE	9851770		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18425803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35123558	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	33846517	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GHSR (growth hormone secretagogue receptor)