Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2687
Gene name	Gamma-glutamyltransferase 5
Gene symbol	GGT5
Synonyms (NCBI Gene)	GGLGGT 5GGT-RELGGTLA1
Chromosome	22
Chromosome location	22q11.23
Summary	This gene is a member of the gamma-glutamyl transpeptidase gene family, and some reports indicate that it is capable of cleaving the gamma-glutamyl moiety of glutathione. The protein encoded by this gene is synthesized as a single, catalytically-inactive

Show/Hide all (39)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004224	hsa-miR-346	Microarray	16822819
MIRT018343	hsa-miR-335-5p	Microarray	18185580
MIRT1018256	hsa-miR-3677-5p	CLIP-seq
MIRT1018257	hsa-miR-4693-3p	CLIP-seq
MIRT1018258	hsa-miR-31	CLIP-seq
MIRT1018259	hsa-miR-4645-5p	CLIP-seq
MIRT1018260	hsa-miR-4673	CLIP-seq
MIRT1018261	hsa-miR-4742-5p	CLIP-seq
MIRT1018262	hsa-miR-658	CLIP-seq
MIRT1549200	hsa-miR-1285	CLIP-seq
MIRT1549201	hsa-miR-2278	CLIP-seq
MIRT1549202	hsa-miR-3187-5p	CLIP-seq
MIRT1549203	hsa-miR-326	CLIP-seq
MIRT1549204	hsa-miR-330-5p	CLIP-seq
MIRT1549205	hsa-miR-378g	CLIP-seq
MIRT1549206	hsa-miR-4486	CLIP-seq
MIRT1549207	hsa-miR-4519	CLIP-seq
MIRT1549208	hsa-miR-499a-5p	CLIP-seq
MIRT1549209	hsa-miR-612	CLIP-seq
MIRT1549200	hsa-miR-1285	CLIP-seq
MIRT1549201	hsa-miR-2278	CLIP-seq
MIRT1549202	hsa-miR-3187-5p	CLIP-seq
MIRT1549203	hsa-miR-326	CLIP-seq
MIRT1549204	hsa-miR-330-5p	CLIP-seq
MIRT1549205	hsa-miR-378g	CLIP-seq
MIRT1549206	hsa-miR-4486	CLIP-seq
MIRT1549207	hsa-miR-4519	CLIP-seq
MIRT1549208	hsa-miR-499a-5p	CLIP-seq
MIRT1549209	hsa-miR-612	CLIP-seq
MIRT1549200	hsa-miR-1285	CLIP-seq
MIRT1549201	hsa-miR-2278	CLIP-seq
MIRT1549202	hsa-miR-3187-5p	CLIP-seq
MIRT1549203	hsa-miR-326	CLIP-seq
MIRT1549204	hsa-miR-330-5p	CLIP-seq
MIRT1549205	hsa-miR-378g	CLIP-seq
MIRT1549206	hsa-miR-4486	CLIP-seq
MIRT1549207	hsa-miR-4519	CLIP-seq
MIRT1549208	hsa-miR-499a-5p	CLIP-seq
MIRT1549209	hsa-miR-612	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000048	Function	Peptidyltransferase activity	IDA	21447318
GO:0002951	Function	Leukotriene-C(4) hydrolase	IBA
GO:0002951	Function	Leukotriene-C(4) hydrolase	IDA	1676842, 21447318
GO:0002951	Function	Leukotriene-C(4) hydrolase	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	1676842
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IDA	1676842
GO:0006508	Process	Proteolysis	IEA
GO:0006520	Process	Amino acid metabolic process	IDA	1676842
GO:0006631	Process	Fatty acid metabolic process	IDA	21447318
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006750	Process	Glutathione biosynthetic process	IEA
GO:0006751	Process	Glutathione catabolic process	IBA
GO:0006751	Process	Glutathione catabolic process	IDA	1676842, 21447318
GO:0006751	Process	Glutathione catabolic process	IEA
GO:0006954	Process	Inflammatory response	IBA
GO:0006954	Process	Inflammatory response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019370	Process	Leukotriene biosynthetic process	IEA
GO:0036374	Function	Glutathione hydrolase activity	IBA
GO:0036374	Function	Glutathione hydrolase activity	IDA	1676842
GO:0036374	Function	Glutathione hydrolase activity	IEA
GO:0103068	Function	Leukotriene C4 gamma-glutamyl transferase activity	IEA
GO:1901750	Process	Leukotriene D4 biosynthetic process	IBA
GO:1901750	Process	Leukotriene D4 biosynthetic process	IDA	1676842, 21447318
GO:1901750	Process	Leukotriene D4 biosynthetic process	IEA
GO:1901750	Process	Leukotriene D4 biosynthetic process	ISS

MIM	HGNC	e!Ensembl
137168	4260	ENSG00000099998

P36269

Protein name

Glutathione hydrolase 5 proenzyme (EC 3.4.19.13) (Gamma-glutamyl transpeptidase-related enzyme) (GGT-rel) (Gamma-glutamyltransferase 5) (GGT 5) (EC 2.3.2.2) (Gamma-glutamyltransferase-like activity 1) (Gamma-glutamyltranspeptidase 5) (Leukotriene-C4 hydro

Protein function

Cleaves the gamma-glutamyl bond of extracellular glutathione tripeptide (gamma-Glu-Cys-Gly) and certain glutathione conjugates (PubMed:1676842, PubMed:21447318). Hydrolyzes glutathione releasing L-Glu and Cys-Gly dipeptide which is further metab

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01019	G_glu_transpept	58 → 581		Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in follicular dendritic cells in lymphoid follicles (at protein level). {ECO:0000269|PubMed:30842656}.

Sequence

MARGYGATVSLVLLGLGLALAVIVLAVVLSRHQAPCGPQAFAHAAVAADSKVCSDIGRAI
LQQQGSPVDATIAALVCTSVVNPQSMGLGGGVIFTIYNVTTGKVEVINARETVPASHAPS
LLDQCAQALPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLFQPTIALLRGGHVVAPVL
SRFLHNSILRPSLQASTLRQLFFNGTEPLRPQDPLPWPALATTLETVATEGVEVFYTGRL
GQMLVEDIAKEGSQLTLQDLAKFQPEVVDALEVPLGDYTLYSPPPPAGGAILSFILNVLR
GFNFSTESMARPEGRVNVYHHLVETLKFAKGQRWRLGDPRSHPKLQNASRDLLGETLAQL
IRQQIDGRGDHQLSHYSLAEAWGHGTGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRT
GIILNNELLDLCERCPRGSGTTPSPVSGDRVGGAPGRCWPPVPGERSPSSMVPSILINKA
QGSKLVIGGAGGELIISAVAQAIMSKLWLGFDLRAAIAAPILHVNSKGCVEYEPNFSQEV
QRGLQDRGQNQTQRPFFLNVVQAVSQEGACVYAVSDLRKSGEAAGY

Sequence length

586

Interactions

View interactions

	KEGG		Reactome
	Taurine and hypotaurine metabolism Glutathione metabolism Arachidonic acid metabolism Metabolic pathways		Glutathione synthesis and recycling Synthesis of Leukotrienes (LT) and Eoxins (EX) Aflatoxin activation and detoxification LTC4-CYSLTR mediated IL4 production

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29051346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	10090893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	29996846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	7643621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	7643621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35257007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34284774, 35257007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	37328520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GGT5 (gamma-glutamyltransferase 5)