HAVCR1 (hepatitis A virus cellular receptor 1)

Gene

• Entrez ID: 26762
• Gene name: Hepatitis A virus cellular receptor 1
• Gene symbol: HAVCR1
• Synonyms (NCBI Gene): CD365, HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1
• Chromosome: 5
• Chromosome location: 5q33.3
• Summary: The protein encoded by this gene is a membrane receptor for both human hepatitis A virus (HHAV) and TIMD4. The encoded protein may be involved in the moderation of asthma and allergic diseases. The reference genome represents an allele that retains a MTTV

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018340	hsa-miR-335-5p	Microarray	18185580
MIRT019312	hsa-miR-148b-3p	Microarray	17612493
MIRT683557	hsa-miR-490-3p	HITS-CLIP	23313552
MIRT683556	hsa-miR-7851-3p	HITS-CLIP	23313552
MIRT683555	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT683554	hsa-miR-6134	HITS-CLIP	23313552
MIRT452214	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT452213	hsa-miR-6086	HITS-CLIP	23313552
MIRT514812	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT683553	hsa-miR-3689d	HITS-CLIP	23313552
MIRT683552	hsa-miR-6851-5p	HITS-CLIP	23313552
MIRT683551	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT683550	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT683549	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT683548	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT683547	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT683546	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT683545	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT452230	hsa-miR-7847-3p	HITS-CLIP	23313552
MIRT452210	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT514811	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT683544	hsa-miR-550b-2-5p	HITS-CLIP	23313552
MIRT514810	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT452238	hsa-miR-302f	PAR-CLIP	20371350
MIRT452237	hsa-miR-6125	PAR-CLIP	20371350
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT452228	hsa-miR-1273e	PAR-CLIP	20371350
MIRT452227	hsa-miR-4484	PAR-CLIP	20371350
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	20371350
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT452215	hsa-miR-1827	PAR-CLIP	20371350
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT452238	hsa-miR-302f	PAR-CLIP	20371350
MIRT452237	hsa-miR-6125	PAR-CLIP	20371350
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT452228	hsa-miR-1273e	PAR-CLIP	20371350
MIRT452227	hsa-miR-4484	PAR-CLIP	20371350
MIRT452238	hsa-miR-302f	PAR-CLIP	21572407
MIRT452237	hsa-miR-6125	PAR-CLIP	21572407
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	21572407
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	21572407
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	21572407
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT452228	hsa-miR-1273e	PAR-CLIP	21572407
MIRT452227	hsa-miR-4484	PAR-CLIP	21572407
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT452222	hsa-miR-940	PAR-CLIP	21572407
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	21572407
MIRT452218	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT452215	hsa-miR-1827	PAR-CLIP	21572407
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT452238	hsa-miR-302f	PAR-CLIP	23446348
MIRT452237	hsa-miR-6125	PAR-CLIP	23446348
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT452228	hsa-miR-1273e	PAR-CLIP	23446348
MIRT452227	hsa-miR-4484	PAR-CLIP	23446348
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT452222	hsa-miR-940	PAR-CLIP	23446348
MIRT452221	hsa-miR-4257	PAR-CLIP	23446348
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT452218	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT452215	hsa-miR-1827	PAR-CLIP	23446348
MIRT452214	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT452213	hsa-miR-6086	PAR-CLIP	23446348
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT514812	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514811	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT514810	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT452238	hsa-miR-302f	PAR-CLIP	23446348
MIRT452237	hsa-miR-6125	PAR-CLIP	23446348
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT452228	hsa-miR-1273e	PAR-CLIP	23446348
MIRT452227	hsa-miR-4484	PAR-CLIP	23446348
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT452215	hsa-miR-1827	PAR-CLIP	23446348
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT452238	hsa-miR-302f	PAR-CLIP	23592263
MIRT452237	hsa-miR-6125	PAR-CLIP	23592263
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT452234	hsa-miR-3197	PAR-CLIP	23592263
MIRT452233	hsa-miR-6087	PAR-CLIP	23592263
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT452229	hsa-miR-6765-5p	PAR-CLIP	23592263
MIRT452228	hsa-miR-1273e	PAR-CLIP	23592263
MIRT452227	hsa-miR-4484	PAR-CLIP	23592263
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT452222	hsa-miR-940	PAR-CLIP	23592263
MIRT452221	hsa-miR-4257	PAR-CLIP	23592263
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	23592263
MIRT452218	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	23592263
MIRT452215	hsa-miR-1827	PAR-CLIP	23592263
MIRT452214	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT452213	hsa-miR-6086	PAR-CLIP	23592263
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT441442	hsa-miR-944	PAR-CLIP	22100165
MIRT441441	hsa-miR-4699-3p	PAR-CLIP	22100165
MIRT441440	hsa-miR-4668-5p	PAR-CLIP	22100165
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	26701625
MIRT452228	hsa-miR-1273e	PAR-CLIP	26701625
MIRT452215	hsa-miR-1827	PAR-CLIP	26701625
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	26701625
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT452238	hsa-miR-302f	PAR-CLIP	26701625
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	26701625
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	26701625
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	26701625
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	26701625
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	26701625
MIRT452222	hsa-miR-940	PAR-CLIP	26701625
MIRT736823	hsa-miR-146a-3p	Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	31666653
MIRT683557	hsa-miR-490-3p	HITS-CLIP	23313552
MIRT683556	hsa-miR-7851-3p	HITS-CLIP	23313552
MIRT683555	hsa-miR-3192-5p	HITS-CLIP	23313552
MIRT683554	hsa-miR-6134	HITS-CLIP	23313552
MIRT452214	hsa-miR-377-5p	HITS-CLIP	23313552
MIRT452213	hsa-miR-6086	HITS-CLIP	23313552
MIRT514812	hsa-miR-6499-3p	HITS-CLIP	23313552
MIRT683553	hsa-miR-3689d	HITS-CLIP	23313552
MIRT683552	hsa-miR-6851-5p	HITS-CLIP	23313552
MIRT683551	hsa-miR-7106-5p	HITS-CLIP	23313552
MIRT683550	hsa-miR-149-3p	HITS-CLIP	23313552
MIRT683549	hsa-miR-4728-5p	HITS-CLIP	23313552
MIRT683548	hsa-miR-6785-5p	HITS-CLIP	23313552
MIRT683547	hsa-miR-6883-5p	HITS-CLIP	23313552
MIRT683546	hsa-miR-6799-5p	HITS-CLIP	23313552
MIRT683545	hsa-miR-1227-3p	HITS-CLIP	23313552
MIRT452230	hsa-miR-7847-3p	HITS-CLIP	23313552
MIRT452210	hsa-miR-6807-5p	HITS-CLIP	23313552
MIRT514811	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT683544	hsa-miR-550b-2-5p	HITS-CLIP	23313552
MIRT514810	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT452238	hsa-miR-302f	PAR-CLIP	20371350
MIRT452237	hsa-miR-6125	PAR-CLIP	20371350
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT452228	hsa-miR-1273e	PAR-CLIP	20371350
MIRT452227	hsa-miR-4484	PAR-CLIP	20371350
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	20371350
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	20371350
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT452215	hsa-miR-1827	PAR-CLIP	20371350
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	20371350
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT452238	hsa-miR-302f	PAR-CLIP	20371350
MIRT452237	hsa-miR-6125	PAR-CLIP	20371350
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	20371350
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	20371350
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	20371350
MIRT452228	hsa-miR-1273e	PAR-CLIP	20371350
MIRT452227	hsa-miR-4484	PAR-CLIP	20371350
MIRT452238	hsa-miR-302f	PAR-CLIP	21572407
MIRT452237	hsa-miR-6125	PAR-CLIP	21572407
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	21572407
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	21572407
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	21572407
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	21572407
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT452228	hsa-miR-1273e	PAR-CLIP	21572407
MIRT452227	hsa-miR-4484	PAR-CLIP	21572407
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	21572407
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	21572407
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT452222	hsa-miR-940	PAR-CLIP	21572407
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	21572407
MIRT452218	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	21572407
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	21572407
MIRT452215	hsa-miR-1827	PAR-CLIP	21572407
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	21572407
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	21572407
MIRT452238	hsa-miR-302f	PAR-CLIP	23446348
MIRT452237	hsa-miR-6125	PAR-CLIP	23446348
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT452228	hsa-miR-1273e	PAR-CLIP	23446348
MIRT452227	hsa-miR-4484	PAR-CLIP	23446348
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	23446348
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	23446348
MIRT452222	hsa-miR-940	PAR-CLIP	23446348
MIRT452221	hsa-miR-4257	PAR-CLIP	23446348
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT452218	hsa-miR-4649-3p	PAR-CLIP	23446348
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT452215	hsa-miR-1827	PAR-CLIP	23446348
MIRT452214	hsa-miR-377-5p	PAR-CLIP	23446348
MIRT452213	hsa-miR-6086	PAR-CLIP	23446348
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT514812	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT514811	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT514810	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT452238	hsa-miR-302f	PAR-CLIP	23446348
MIRT452237	hsa-miR-6125	PAR-CLIP	23446348
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	23446348
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	23446348
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	23446348
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	23446348
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT452228	hsa-miR-1273e	PAR-CLIP	23446348
MIRT452227	hsa-miR-4484	PAR-CLIP	23446348
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	23446348
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	23446348
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	23446348
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	23446348
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	23446348
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT452215	hsa-miR-1827	PAR-CLIP	23446348
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	23446348
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT452238	hsa-miR-302f	PAR-CLIP	23592263
MIRT452237	hsa-miR-6125	PAR-CLIP	23592263
MIRT452236	hsa-miR-6746-5p	PAR-CLIP	23592263
MIRT452235	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT452234	hsa-miR-3197	PAR-CLIP	23592263
MIRT452233	hsa-miR-6087	PAR-CLIP	23592263
MIRT452232	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT452231	hsa-miR-6880-5p	PAR-CLIP	23592263
MIRT452230	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT452229	hsa-miR-6765-5p	PAR-CLIP	23592263
MIRT452228	hsa-miR-1273e	PAR-CLIP	23592263
MIRT452227	hsa-miR-4484	PAR-CLIP	23592263
MIRT452226	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT452225	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT452224	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT452223	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT452222	hsa-miR-940	PAR-CLIP	23592263
MIRT452221	hsa-miR-4257	PAR-CLIP	23592263
MIRT452220	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT452219	hsa-miR-4740-3p	PAR-CLIP	23592263
MIRT452218	hsa-miR-4649-3p	PAR-CLIP	23592263
MIRT452217	hsa-miR-1225-3p	PAR-CLIP	23592263
MIRT452216	hsa-miR-1233-3p	PAR-CLIP	23592263
MIRT452215	hsa-miR-1827	PAR-CLIP	23592263
MIRT452214	hsa-miR-377-5p	PAR-CLIP	23592263
MIRT452213	hsa-miR-6086	PAR-CLIP	23592263
MIRT452212	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT452211	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT452210	hsa-miR-6807-5p	PAR-CLIP	23592263
MIRT441442	hsa-miR-944	PAR-CLIP	22100165
MIRT441441	hsa-miR-4699-3p	PAR-CLIP	22100165
MIRT441440	hsa-miR-4668-5p	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IBA
GO:0001618	Function	Virus receptor activity	IDA	21536871
GO:0001618	Function	Virus receptor activity	IEA
GO:0001786	Function	Phosphatidylserine binding	IBA
GO:0005515	Function	Protein binding	IPI	32995803, 33493263
GO:0005886	Component	Plasma membrane	IEA
GO:0006911	Process	Phagocytosis, engulfment	IBA
GO:0009986	Component	Cell surface	IBA
GO:0016020	Component	Membrane	IEA
GO:0031514	Component	Motile cilium	IDA	21536871
GO:0033005	Process	Positive regulation of mast cell activation	IBA
GO:0046718	Process	Symbiont entry into host cell	IEA

Other IDs

• MIM: 606518
• HGNC: 17866
• e!Ensembl: ENSG00000113249

Protein

• UniProt ID: Q96D42
• Protein name: Hepatitis A virus cellular receptor 1 (HAVcr-1) (Kidney injury molecule 1) (KIM-1) (T-cell immunoglobulin and mucin domain-containing protein 1) (TIMD-1) (T-cell immunoglobulin mucin receptor 1) (TIM) (TIM-1) (T-cell membrane protein 1) (CD antigen CD365)
• Protein function: Phosphatidylserine receptor that plays an important functional role in regulatory B-cells homeostasis including generation, expansion and suppressor functions (By similarity). As P-selectin/SELPLG ligand, plays a specialized role in activated bu
• PDB: 5DZO, 5F70
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	20 → 124	Immunoglobulin V-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with highest levels in kidney and testis. Expressed by activated CD4+ T-cells during the development of helper T-cells responses. {ECO:0000269|PubMed:9658108}.
• Sequence:

  MHPQVVILSLILHLADSVAGSVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNG
  IVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENTAVSDSGVYCCRVEHRGWFNDMKITV
  SLEIVPPKVTTTPIVTTVPTVTTVRTSTTVPTTTTVPMTTVPTTTVPTTMSIPTTTTVLT
  TMTVSTTTSVPTTTSIPTTTSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPT
  TLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGIYAGV
  CISVLVLLALLGVIIAKKYFFKKEVQQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSL
  YATD

• Sequence length: 364

Pathways

KEGG:

Virion - Flavivirus and Alphavirus
Efferocytosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOCAL GLOMERULOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HAVCR1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERLIPIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTRIGLYCERIDEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	30477800		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	20118187, 21259293, 21835770, 22005293, 23052191, 23845967, 24189134, 24361871, 24958931, 28885000		★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	BEFREE	31623859		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20232767, 23406933, 23800473		★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31641850		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29936416		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	16481347		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	11725301, 12618867, 14630400, 14637143, 15153541, 15683615, 15867855, 16938542, 17117951, 17277130, 17570927, 18727494, 19476019, 19494522, 20415862, 20727045, 21339644, 21470319, 22857392, 23406933, 25152377, 25331534, 26041148, 28434117		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	17570927		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19476019, 21339644	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	22324461		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29936416		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27609943		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	25884518	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	29698674, 30590210		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15565336, 16938542, 18727494, 20549518, 22190394, 22857392, 23406933, 24412470, 27091308, 28103916, 31044630		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22190394	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	31644615		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	24636202		★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	22343120, 30909833	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	12081583	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25546329		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	14662653, 28464854		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23267147		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40465781	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27671527, 31138322, 31358938		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	15744000, 32472319	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	27818477		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27818477		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28254771, 29295851, 30641399		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	38014560	Associate	★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	31800133		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29208769	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32460577	Stimulate	★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	25884518, 30659575		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	19476019, 19494522		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	25784666, 30035656, 30499038, 31227289		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	26317775, 28054933, 28214834, 28380198, 28476556, 28614696, 28617070, 28777303, 28884615, 30078006, 30133147, 30201372, 30641399, 30873045, 31793871		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26921445		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23267147		★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	GWASDB_DG	21497890		★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	31793232		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28254771, 28614696, 28967680, 30230666, 30551588, 31129929		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23352434, 23979814, 24390735, 27671527, 29052086, 29295730, 30037816, 31385177		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	35263363	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	29208769	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29208769		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	32184430	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27585963, 29572451		★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	27876501		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	14637143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	BEFREE	16940744		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	25784666, 28639369, 28822965, 31483944		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	25784666, 28639369, 28822965, 29122892, 31483944		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34285121, 35966054	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	35754999, 35966054	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25784666, 27771693, 29122892, 31168341		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28822965, 29279420, 30288572, 31100493, 31110596, 31250339		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31805809, 33122288, 34285121, 35843953	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32853351	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25784666, 28476763, 29209813, 29990842, 30396700, 31168341, 31250339, 31373312, 31483944, 31679767, 31805809		★☆☆☆☆ Found in Text Mining only
Diarrhea 5 With Tufting Enteropathy Congenital	Congenital diarrhea	Pubtator	23988168	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	27709813		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	16159638, 16940744		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21470319		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	28683730, 30058582		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	19225054		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	31666653		★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	30699409		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30967588		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	28408386		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28254771, 28614696, 28967680, 30230666, 30551588, 31129929		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28967680	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37707956	Stimulate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	23353785, 26125859, 29122357		★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22190394, 29321304	Associate	★☆☆☆☆ Found in Text Mining only
Hyalinosis, Segmental Glomerular	Glomerular Hyalinosis	CTD_human_DG	19225054		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	27852120, 30327688, 30694385, 30791405, 30979613		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	22984472		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	31309599		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29122892, 29693449, 30259632		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	30078006		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28116659		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30110569	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30924565		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	26125859, 30347407, 31606236		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	18052965, 27818477, 30972157		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	18052965, 22080624	Associate	★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	24412470		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30623722		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29208769		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12081583, 20019169, 23988168, 25884518, 31936266, 32541154, 32853351, 34285121, 35577796, 36215909, 36418822, 37511523, 37707956, 37942539	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	19349640, 20181666, 20438795, 21888673, 23019274, 24863737, 24880025		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	24158981, 24282337, 28214834, 29247633, 30201372, 30972157		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	20118187, 21259293, 21835770, 22005293, 23052191, 23845967, 24189134, 24361871, 24958931, 28885000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	21321005, 27020372, 27122240, 27367527, 27741065, 27852120, 28011057, 28063188, 28075469, 28124458, 28187124, 28212617, 28214834, 28409285, 28411423, 28419138, 28573544, 28588686, 28755073, 28803934, 28822965, 28840836, 28844586, 29028077, 29074644, 29258482, 29291761, 29529007, 29633705, 29682165, 29693725, 29699579, 29732744, 29733821, 29784944, 29909065, 29950613, 29985717, 30078006, 30144701, 30342853, 30393493, 30461328, 30552306, 30641399, 30700847, 30730758, 30873045, 30909833, 30972157, 31084615, 31125610, 31279782, 31296157, 31474993, 31553742, 31591120, 31599006, 31646460, 31652595, 31732832		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Chronic	Kidney Failure	BEFREE	25784666, 30035656, 30499038, 31227289		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	23979814, 30282451		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29113224, 29437974, 30526680		★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	21339644	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	BEFREE	21339636		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	21339644	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	21339644		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29437974, 30282451		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31138322	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18052965	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18052965, 20140011, 20549518, 21367814, 28371471, 30183357		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18052965		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	26125859, 28361601, 30020021		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	28408386		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	25546329		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	14662653, 28464854		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23979814, 24158981, 30037816		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31138322, 31358938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27671527		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30388143		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23352434, 24336162, 26921445, 27580018, 27671527, 29113224, 30037816		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26921445		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14662653		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28848066		★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	10878669		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15153541, 20070602, 27091308, 29141799		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21454294		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28777704, 28994186, 30663266		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19424580, 21775055, 22081375, 23352434, 23979814, 24336162, 24390735, 27413764, 27671527, 28771750, 29052086, 29295730, 29399413, 30282451, 30388143, 31076549, 31078776, 31227543, 31669380		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	29122357		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	28493961		★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	30979613		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30979613		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	29661344		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31138322		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30035656, 31373312		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	38014560	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28583714		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	27671527		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32472319	Associate	★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	23979814		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	19480659	Inhibit	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28583714		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	29876944	Associate	★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	31078776		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	32541154	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	31600749		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27709813		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	23026578	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35204839	Associate	★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	24282337	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proteinuria	Proteinuria	Pubtator	29490294	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35263363	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23979814, 24158981, 30037816		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	15086915		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23979814, 24390735, 27671527, 29052086, 30037816, 31385177		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28214834, 28235038, 29026167, 30439378		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28979697, 29603641, 31074472, 31302846		★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	29245956, 30909833		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29392553		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	14985107, 15565336, 20549518, 22290466, 22353209, 23406933, 25899833, 30730912, 31044630		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	20232767	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	19480659		★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	19480659	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	28103916	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	34112226	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29074644, 30461328		★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	25899833		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	27102916		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30388143		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30388143, 34002670	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32460577	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	38014560	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28103916		★☆☆☆☆ Found in Text Mining only
Urethral Obstruction	Urethral Obstruction	BEFREE	30461328		★☆☆☆☆ Found in Text Mining only
Urolithiasis	Urolithiasis	BEFREE	28653226		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35392845	Associate	★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	27562389	Associate	★☆☆☆☆ Found in Text Mining only