Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	26751
Gene name	SH3 and SYLF domain containing 1
Gene symbol	SH3YL1
Synonyms (NCBI Gene)	RAY
Chromosome	2
Chromosome location	2p25.3

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments
MIRT1346025	hsa-miR-142-5p	CLIP-seq
MIRT1346026	hsa-miR-146a	CLIP-seq
MIRT1346027	hsa-miR-146b-5p	CLIP-seq
MIRT1346028	hsa-miR-153	CLIP-seq
MIRT1346029	hsa-miR-190	CLIP-seq
MIRT1346030	hsa-miR-190b	CLIP-seq
MIRT1346031	hsa-miR-223	CLIP-seq
MIRT1346032	hsa-miR-3145-3p	CLIP-seq
MIRT1346033	hsa-miR-3616-5p	CLIP-seq
MIRT1346034	hsa-miR-3647-5p	CLIP-seq
MIRT1346035	hsa-miR-3689a-5p	CLIP-seq
MIRT1346036	hsa-miR-3689b	CLIP-seq
MIRT1346037	hsa-miR-3689e	CLIP-seq
MIRT1346038	hsa-miR-3689f	CLIP-seq
MIRT1346039	hsa-miR-371-5p	CLIP-seq
MIRT1346040	hsa-miR-371b-5p	CLIP-seq
MIRT1346041	hsa-miR-3923	CLIP-seq
MIRT1346042	hsa-miR-3925-5p	CLIP-seq
MIRT1346043	hsa-miR-3973	CLIP-seq
MIRT1346044	hsa-miR-425	CLIP-seq
MIRT1346045	hsa-miR-4255	CLIP-seq
MIRT1346046	hsa-miR-4280	CLIP-seq
MIRT1346047	hsa-miR-4302	CLIP-seq
MIRT1346048	hsa-miR-4421	CLIP-seq
MIRT1346049	hsa-miR-4457	CLIP-seq
MIRT1346050	hsa-miR-4697-3p	CLIP-seq
MIRT1346051	hsa-miR-4704-3p	CLIP-seq
MIRT1346052	hsa-miR-4775	CLIP-seq
MIRT1346053	hsa-miR-4795-5p	CLIP-seq
MIRT1346054	hsa-miR-493	CLIP-seq
MIRT1346055	hsa-miR-513b	CLIP-seq
MIRT1346056	hsa-miR-520d-5p	CLIP-seq
MIRT1346057	hsa-miR-524-5p	CLIP-seq
MIRT1346058	hsa-miR-548g	CLIP-seq
MIRT1346059	hsa-miR-548l	CLIP-seq
MIRT1346060	hsa-miR-556-5p	CLIP-seq
MIRT1346061	hsa-miR-561	CLIP-seq
MIRT1346062	hsa-miR-573	CLIP-seq
MIRT1346063	hsa-miR-590-3p	CLIP-seq
MIRT1346064	hsa-miR-595	CLIP-seq
MIRT1346065	hsa-miR-605	CLIP-seq
MIRT1346066	hsa-miR-628-3p	CLIP-seq
MIRT1346067	hsa-miR-642b	CLIP-seq
MIRT1346025	hsa-miR-142-5p	CLIP-seq
MIRT1346031	hsa-miR-223	CLIP-seq
MIRT2102346	hsa-miR-3189-5p	CLIP-seq
MIRT2102347	hsa-miR-3646	CLIP-seq
MIRT1346035	hsa-miR-3689a-5p	CLIP-seq
MIRT1346036	hsa-miR-3689b	CLIP-seq
MIRT1346037	hsa-miR-3689e	CLIP-seq
MIRT1346038	hsa-miR-3689f	CLIP-seq
MIRT1346041	hsa-miR-3923	CLIP-seq
MIRT2102348	hsa-miR-3943	CLIP-seq
MIRT1346044	hsa-miR-425	CLIP-seq
MIRT1346046	hsa-miR-4280	CLIP-seq
MIRT1346047	hsa-miR-4302	CLIP-seq
MIRT2102349	hsa-miR-4323	CLIP-seq
MIRT1346048	hsa-miR-4421	CLIP-seq
MIRT1346050	hsa-miR-4697-3p	CLIP-seq
MIRT1346061	hsa-miR-561	CLIP-seq
MIRT1346064	hsa-miR-595	CLIP-seq
MIRT1346065	hsa-miR-605	CLIP-seq
MIRT1346066	hsa-miR-628-3p	CLIP-seq
MIRT1346067	hsa-miR-642b	CLIP-seq
MIRT2102350	hsa-miR-875-3p	CLIP-seq
MIRT2326886	hsa-miR-1287	CLIP-seq
MIRT2326887	hsa-miR-3135b	CLIP-seq
MIRT2326888	hsa-miR-3146	CLIP-seq
MIRT2102347	hsa-miR-3646	CLIP-seq
MIRT2326889	hsa-miR-491-3p	CLIP-seq
MIRT2102350	hsa-miR-875-3p	CLIP-seq
MIRT2459299	hsa-miR-4263	CLIP-seq
MIRT2459300	hsa-miR-4521	CLIP-seq
MIRT1346025	hsa-miR-142-5p	CLIP-seq
MIRT1346035	hsa-miR-3689a-5p	CLIP-seq
MIRT1346036	hsa-miR-3689b	CLIP-seq
MIRT1346037	hsa-miR-3689e	CLIP-seq
MIRT1346038	hsa-miR-3689f	CLIP-seq
MIRT1346043	hsa-miR-3973	CLIP-seq
MIRT1346056	hsa-miR-520d-5p	CLIP-seq
MIRT1346057	hsa-miR-524-5p	CLIP-seq
MIRT1346059	hsa-miR-548l	CLIP-seq
MIRT1346061	hsa-miR-561	CLIP-seq
MIRT1346064	hsa-miR-595	CLIP-seq
MIRT1346067	hsa-miR-642b	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16189514, 21516116, 25416956, 28514442, 32296183, 33961781
GO:0006661	Process	Phosphatidylinositol biosynthetic process	IEA
GO:0019902	Function	Phosphatase binding	IDA	21624956
GO:0032587	Component	Ruffle membrane	IBA
GO:0032587	Component	Ruffle membrane	IDA	21624956
GO:0035091	Function	Phosphatidylinositol binding	IBA
GO:0035091	Function	Phosphatidylinositol binding	IDA	21624956
GO:1900027	Process	Regulation of ruffle assembly	IBA
GO:1900027	Process	Regulation of ruffle assembly	IEA

MIM	HGNC	e!Ensembl
617314	29546	ENSG00000035115

Q96HL8

Protein name

SH3 domain-containing YSC84-like protein 1

PDB

2D8H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04366	Ysc84	86 → 210	Las17-binding protein actin regulator	Family
PF00018	SH3_1	289 → 336	SH3 domain	Domain

Sequence

MNNPIPSNLKSEAKKAAKILREFTEITSRNGPDKIIPAHVIAKAKGLAILSVIKAGFLVT
ARGGSGIVVARLPDGKWSAPSAIGIAGLGGGFEIGIEVSDLVIILNYDRAVEAFAKGGNL
TLGGNLTVAVGPLGRNLEGNVALRSSAAVFTYCKSRGLFAGVSLEGSCLIERKETNRKFY
CQDIRAYDILFGDTPRPAQAEDLYEILDSFTEKYENEGQRINARKAAREQRKSSAKELPP
KPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVGNLNQPIEVTALYSFEGQQPG
DLNFQAGDRITVISKTDSHFDWWEGKLRGQTGIFPANYVTMN

Sequence length

342

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28556689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31427643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	31427643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	31686588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	40362200	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SH3YL1 (SH3 and SYLF domain containing 1)