DAOA (D-amino acid oxidase activator)

Gene

• Entrez ID: 267012
• Gene name: D-amino acid oxidase activator
• Gene symbol: DAOA
• Synonyms (NCBI Gene): LG72, SG72
• Chromosome: 13
• Chromosome location: 13q33.2|13q34
• Summary: This gene encodes a protein that may function as an activator of D-amino acid oxidase, which degrades the gliotransmitter D-serine, a potent activator of N-methyl-D-aspartate (NMDA) type glutamate receptors. Studies also suggest that one encoded isoform m

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	12364586, 20521334, 21679769, 37805834
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	17684499, 21679769
GO:0005739	Component	Mitochondrion	IEA
GO:0005794	Component	Golgi apparatus	IDA	12364586
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	21679769, 37805834
GO:0046416	Process	D-amino acid metabolic process	IDA	12364586, 21679769
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	21679769

Other IDs

• MIM: 607408
• HGNC: 21191
• e!Ensembl: ENSG00000182346

Protein

• UniProt ID: P59103
• Protein name: D-amino acid oxidase regulator (Protein G72)
• Protein function: May suppress DAO (D-amino acid oxidase) and SOD1 activity and promote their degradation (PubMed:18544534, PubMed:20521334, PubMed:21679769, PubMed:30037290). Has conversely also been suggested to function as a DAO activator (PubMed:12364586, Pub
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15199	DAOA	72 → 153	D-amino acid oxidase activator	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the amygdala and in astrocytes of the cortex (at protein level) (PubMed:12364586, PubMed:17684499, PubMed:18544534). Expressed in the caudate nucleus, spinal cord and testis (PubMed:12364586). {ECO:0000269|PubMed:12364586,
• Sequence:

  MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEG
  WKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSSHVGKVFMARNYEFLAYEASK
  DRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE

• Sequence length: 153

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	20005295, 20667145		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	PSYGENET_DG	20005295, 20667145		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26949549	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	26949549		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	17629951		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22429365		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	LHGDN	14966479, 17684499, 18165970		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	15057823, 18466879, 19194963, 20336655, 20667145, 21391259, 22438288, 23861766	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	15744031, 16263850, 16585465, 17728666, 18023149, 19194963, 19689504, 21391259, 21443574, 22429365, 23861766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20957330, 22429365, 22438288, 23861766, 24447945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	23861766		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19778423	Associate	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	HPO_DG			★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	19708722, 24447945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	19708722, 24447945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	20667145, 26949549	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	20336655	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	20009237		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16554747, 23861766		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	16263850		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20336655, 21438144, 22429365, 22851402, 25043320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	22429365, 22851402, 25043320, 28477547		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Manic	Manic Disorder	BEFREE	18466879		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	19708722, 20667145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	19708722, 20667145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	19778423, 20336655, 20667145, 21716263, 23337943, 23861766, 24447945		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16585465, 19089835, 20667145		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	16585465, 19089835, 19708722, 20667145, 21438144		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	16263850, 16585465, 18466879, 19482054, 19763662, 21391259, 23632455, 26142836		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	15477870		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	16263850, 16585465, 17890006, 18466879, 19482054, 19763662, 21391259, 21443574, 23632455, 26142836, 26803614		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	LHGDN	17492767		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	18466879, 21391259, 26949549	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12364586, 15194506, 15271585, 15744031, 16263850, 16554747, 16585465, 16612196, 16842973, 17055463, 17152404, 17293043, 17408693, 17627036, 18023149, 18423426, 18541412, 19237267, 19482054, 19560517, 19591808, 19763662, 20005295, 20336655, 20483474, 21215384, 21391259, 21443574, 21508934, 22122005, 22438288, 22499782, 23286827, 23335491, 23495896, 24447945, 24557696, 25263995, 26142836, 27412497, 27815320, 28197415, 28285246, 28477547, 30459659		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12364586, 14966479, 15194506, 15271585, 15738936, 16554747, 16791105, 17179078, 17179866, 17250995, 17293043, 17492767, 17684499, 17767147, 17880399, 18023149, 18423426, 18516516, 18541412, 19077230		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	15057823, 18541412, 20336655, 22438288, 23286827, 28197415, 33986383	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	20336655, 21438144, 22429365, 22851402, 25043320		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	22429365, 22851402, 25043320, 28477547		★★☆☆☆ Found in Text Mining + Unknown/Other Associations