Gene Gene information from NCBI Gene database.
Entrez ID 266812
Gene name Nucleosome assembly protein 1 like 5
Gene symbol NAP1L5
Synonyms (NCBI Gene)
DRLM
Chromosome 4
Chromosome location 4q22.1|4q21-q22
Summary This gene encodes a protein that shares sequence similarity to nucleosome assembly factors, but may be localized to the cytoplasm rather than the nucleus. Expression of this gene is downregulated in hepatocellular carcinomas. This gene is located within a
miRNA miRNA information provided by mirtarbase database.
129
miRTarBase ID miRNA Experiments Reference
MIRT440151 hsa-miR-381-3p HITS-CLIP 24374217
MIRT440151 hsa-miR-381-3p HITS-CLIP 24374217
MIRT1173737 hsa-miR-1236 CLIP-seq
MIRT1173738 hsa-miR-1253 CLIP-seq
MIRT1173739 hsa-miR-1297 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
3
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
GO:0006334 Process Nucleosome assembly IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
612203 19968 ENSG00000177432
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96NT1
Protein name Nucleosome assembly protein 1-like 5 (Down-regulated in liver malignancy)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00956 NAP 79 175 Nucleosome assembly protein (NAP) Family
Tissue specificity TISSUE SPECIFICITY: Predominantly expressed in brain. {ECO:0000269|PubMed:12383514}.
Sequence
MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAE
NAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKI
QELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAE
MPDDA
KK
Sequence length 182
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Breast Neoplasms Breast neoplasm Pubtator 36689360 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 36374212 Inhibit
★☆☆☆☆
Found in Text Mining only
Heart Defects Congenital Congenital heart defect Pubtator 33407475 Associate
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 12383514
★☆☆☆☆
Found in Text Mining only
Obesity Obesity BEFREE 20622171
★☆☆☆☆
Found in Text Mining only
Obesity Obesity Pubtator 20622171 Associate
★☆☆☆☆
Found in Text Mining only