GDNF (glial cell derived neurotrophic factor)

Gene

• Entrez ID: 2668
• Gene name: Glial cell derived neurotrophic factor
• Gene symbol: GDNF
• Synonyms (NCBI Gene): ATF, ATF1, ATF2, HFB1-GDNF, HSCR3
• Chromosome: 5
• Chromosome location: 5p13.2
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs36119840	G>A	Pathogenic, risk-factor, likely-benign	Coding sequence variant, missense variant
rs104893891	T>A,C	Risk-factor	Coding sequence variant, missense variant
rs121918536	G>C	Risk-factor	Coding sequence variant, missense variant
rs375385439	C>A,T	Conflicting-interpretations-of-pathogenicity	Intron variant, coding sequence variant, synonymous variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019438	hsa-miR-148b-3p	Microarray	17612493
MIRT022032	hsa-miR-128-3p	Microarray	17612493
MIRT025911	hsa-miR-7-5p	Microarray	17612493
MIRT630717	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT630716	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT630715	hsa-miR-8485	HITS-CLIP	23824327
MIRT630714	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT630713	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT630712	hsa-miR-603	HITS-CLIP	23824327
MIRT630711	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT630710	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT630709	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT630708	hsa-miR-3941	HITS-CLIP	23824327
MIRT630707	hsa-miR-4672	HITS-CLIP	23824327
MIRT630706	hsa-miR-466	HITS-CLIP	23824327
MIRT630705	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT572238	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT572237	hsa-miR-1912	PAR-CLIP	20371350
MIRT572236	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT572235	hsa-miR-4499	PAR-CLIP	20371350
MIRT572233	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT572234	hsa-miR-4304	PAR-CLIP	20371350
MIRT572232	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT395981	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT559413	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT559412	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT559411	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT559410	hsa-miR-548an	PAR-CLIP	20371350
MIRT559409	hsa-miR-8066	PAR-CLIP	20371350
MIRT559408	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT559407	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT559406	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT559405	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT559404	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT568436	hsa-miR-548aw	PAR-CLIP	20371350
MIRT559403	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT559402	hsa-miR-448	PAR-CLIP	20371350
MIRT559401	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT559400	hsa-miR-507	PAR-CLIP	20371350
MIRT559399	hsa-miR-557	PAR-CLIP	20371350
MIRT559398	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT568435	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT568434	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT568433	hsa-miR-4255	PAR-CLIP	20371350
MIRT568432	hsa-miR-4307	PAR-CLIP	20371350
MIRT568431	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT568430	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT568429	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT568428	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT559413	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT559412	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT559411	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT559410	hsa-miR-548an	PAR-CLIP	21572407
MIRT559409	hsa-miR-8066	PAR-CLIP	21572407
MIRT559408	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT559407	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT559406	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT559405	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT559404	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT559403	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT559402	hsa-miR-448	PAR-CLIP	21572407
MIRT559401	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT559400	hsa-miR-507	PAR-CLIP	21572407
MIRT559399	hsa-miR-557	PAR-CLIP	21572407
MIRT559398	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT539075	hsa-miR-4282	PAR-CLIP	22012620
MIRT539074	hsa-miR-140-3p	PAR-CLIP	22012620
MIRT734622	hsa-miR-96-5p	In situ hybridization, Luciferase reporter assay	26681446
MIRT734622	hsa-miR-96-5p	Microarray	31751571
MIRT630717	hsa-miR-3129-3p	HITS-CLIP	23824327
MIRT630716	hsa-miR-5583-5p	HITS-CLIP	23824327
MIRT630715	hsa-miR-8485	HITS-CLIP	23824327
MIRT630714	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT630713	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT630712	hsa-miR-603	HITS-CLIP	23824327
MIRT630711	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT630710	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT630709	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT630708	hsa-miR-3941	HITS-CLIP	23824327
MIRT630707	hsa-miR-4672	HITS-CLIP	23824327
MIRT630706	hsa-miR-466	HITS-CLIP	23824327
MIRT630705	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT572238	hsa-miR-1295b-5p	PAR-CLIP	20371350
MIRT572237	hsa-miR-1912	PAR-CLIP	20371350
MIRT572236	hsa-miR-4724-5p	PAR-CLIP	20371350
MIRT572235	hsa-miR-4499	PAR-CLIP	20371350
MIRT572233	hsa-miR-499b-5p	PAR-CLIP	20371350
MIRT572234	hsa-miR-4304	PAR-CLIP	20371350
MIRT572232	hsa-miR-3124-3p	PAR-CLIP	20371350
MIRT395981	hsa-miR-129-5p	PAR-CLIP	20371350
MIRT559413	hsa-miR-19a-3p	PAR-CLIP	20371350
MIRT559412	hsa-miR-19b-3p	PAR-CLIP	20371350
MIRT559411	hsa-miR-548e-5p	PAR-CLIP	20371350
MIRT559410	hsa-miR-548an	PAR-CLIP	20371350
MIRT559409	hsa-miR-8066	PAR-CLIP	20371350
MIRT559408	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT559407	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT559406	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT559405	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT559404	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT568436	hsa-miR-548aw	PAR-CLIP	20371350
MIRT559403	hsa-miR-153-3p	PAR-CLIP	20371350
MIRT559402	hsa-miR-448	PAR-CLIP	20371350
MIRT559401	hsa-miR-450b-5p	PAR-CLIP	20371350
MIRT559400	hsa-miR-507	PAR-CLIP	20371350
MIRT559399	hsa-miR-557	PAR-CLIP	20371350
MIRT559398	hsa-miR-3680-3p	PAR-CLIP	20371350
MIRT568435	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT568434	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT568433	hsa-miR-4255	PAR-CLIP	20371350
MIRT568432	hsa-miR-4307	PAR-CLIP	20371350
MIRT568431	hsa-miR-302b-5p	PAR-CLIP	20371350
MIRT568430	hsa-miR-302d-5p	PAR-CLIP	20371350
MIRT568429	hsa-miR-2116-5p	PAR-CLIP	20371350
MIRT568428	hsa-miR-22-5p	PAR-CLIP	20371350
MIRT559413	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT559412	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT559411	hsa-miR-548e-5p	PAR-CLIP	21572407
MIRT559410	hsa-miR-548an	PAR-CLIP	21572407
MIRT559409	hsa-miR-8066	PAR-CLIP	21572407
MIRT559408	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT559407	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT559406	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT559405	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT559404	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT559403	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT559402	hsa-miR-448	PAR-CLIP	21572407
MIRT559401	hsa-miR-450b-5p	PAR-CLIP	21572407
MIRT559400	hsa-miR-507	PAR-CLIP	21572407
MIRT559399	hsa-miR-557	PAR-CLIP	21572407
MIRT559398	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT539075	hsa-miR-4282	PAR-CLIP	22012620
MIRT539074	hsa-miR-140-3p	PAR-CLIP	22012620
MIRT755695	hsa-miR-211-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	36569394
MIRT1015906	hsa-miR-1184	CLIP-seq
MIRT1015907	hsa-miR-1245b-5p	CLIP-seq
MIRT1015908	hsa-miR-1290	CLIP-seq
MIRT1015909	hsa-miR-1915	CLIP-seq
MIRT1015910	hsa-miR-3142	CLIP-seq
MIRT1015911	hsa-miR-3165	CLIP-seq
MIRT1015912	hsa-miR-3167	CLIP-seq
MIRT1015913	hsa-miR-3622b-5p	CLIP-seq
MIRT1015914	hsa-miR-3691-5p	CLIP-seq
MIRT1015915	hsa-miR-4302	CLIP-seq
MIRT1015916	hsa-miR-4418	CLIP-seq
MIRT1015917	hsa-miR-4468	CLIP-seq
MIRT1015918	hsa-miR-4493	CLIP-seq
MIRT1015919	hsa-miR-4726-3p	CLIP-seq
MIRT1015920	hsa-miR-4747-5p	CLIP-seq
MIRT1015921	hsa-miR-4752	CLIP-seq
MIRT1015922	hsa-miR-509-3-5p	CLIP-seq
MIRT1015923	hsa-miR-509-5p	CLIP-seq
MIRT1015924	hsa-miR-876-5p	CLIP-seq
MIRT1015925	hsa-miR-891b	CLIP-seq
MIRT1015926	hsa-miR-939	CLIP-seq
MIRT1015927	hsa-miR-3115	CLIP-seq
MIRT1015928	hsa-miR-3119	CLIP-seq
MIRT1015929	hsa-miR-3147	CLIP-seq
MIRT1015930	hsa-miR-3148	CLIP-seq
MIRT1015931	hsa-miR-3155	CLIP-seq
MIRT1015932	hsa-miR-3155b	CLIP-seq
MIRT1015933	hsa-miR-3591-3p	CLIP-seq
MIRT1015934	hsa-miR-3667-3p	CLIP-seq
MIRT1015935	hsa-miR-4287	CLIP-seq
MIRT1015936	hsa-miR-4297	CLIP-seq
MIRT1015937	hsa-miR-4311	CLIP-seq
MIRT1015938	hsa-miR-4425	CLIP-seq
MIRT1015939	hsa-miR-4469	CLIP-seq
MIRT1015940	hsa-miR-4475	CLIP-seq
MIRT1015941	hsa-miR-450b-3p	CLIP-seq
MIRT1015942	hsa-miR-4652-3p	CLIP-seq
MIRT1015943	hsa-miR-4668-5p	CLIP-seq
MIRT1015944	hsa-miR-4684-5p	CLIP-seq
MIRT1015945	hsa-miR-4685-3p	CLIP-seq
MIRT1015946	hsa-miR-4691-5p	CLIP-seq
MIRT1015947	hsa-miR-4778-3p	CLIP-seq
MIRT1015948	hsa-miR-484	CLIP-seq
MIRT1015949	hsa-miR-520g	CLIP-seq
MIRT1015950	hsa-miR-520h	CLIP-seq
MIRT1015951	hsa-miR-642a	CLIP-seq
MIRT1015952	hsa-miR-769-3p	CLIP-seq
MIRT1015953	hsa-miR-942	CLIP-seq
MIRT1015906	hsa-miR-1184	CLIP-seq
MIRT2000764	hsa-miR-122	CLIP-seq
MIRT2000765	hsa-miR-3135b	CLIP-seq
MIRT2000766	hsa-miR-3137	CLIP-seq
MIRT1015913	hsa-miR-3622b-5p	CLIP-seq
MIRT2000767	hsa-miR-3652	CLIP-seq
MIRT1015934	hsa-miR-3667-3p	CLIP-seq
MIRT2000768	hsa-miR-3929	CLIP-seq
MIRT1015936	hsa-miR-4297	CLIP-seq
MIRT1015916	hsa-miR-4418	CLIP-seq
MIRT2000769	hsa-miR-4419b	CLIP-seq
MIRT2000770	hsa-miR-4430	CLIP-seq
MIRT2000771	hsa-miR-4478	CLIP-seq
MIRT2000772	hsa-miR-4659a-3p	CLIP-seq
MIRT2000773	hsa-miR-4659b-3p	CLIP-seq
MIRT1015946	hsa-miR-4691-5p	CLIP-seq
MIRT1015947	hsa-miR-4778-3p	CLIP-seq
MIRT1015922	hsa-miR-509-3-5p	CLIP-seq
MIRT1015923	hsa-miR-509-5p	CLIP-seq
MIRT2000774	hsa-miR-659	CLIP-seq
MIRT2000775	hsa-miR-668	CLIP-seq
MIRT1015946	hsa-miR-4691-5p	CLIP-seq
MIRT1015946	hsa-miR-4691-5p	CLIP-seq
MIRT2000764	hsa-miR-122	CLIP-seq
MIRT2000765	hsa-miR-3135b	CLIP-seq
MIRT1015913	hsa-miR-3622b-5p	CLIP-seq
MIRT2000767	hsa-miR-3652	CLIP-seq
MIRT2000768	hsa-miR-3929	CLIP-seq
MIRT2000769	hsa-miR-4419b	CLIP-seq
MIRT2000770	hsa-miR-4430	CLIP-seq
MIRT2000771	hsa-miR-4478	CLIP-seq
MIRT1015947	hsa-miR-4778-3p	CLIP-seq
MIRT2000775	hsa-miR-668	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EGR1	Unknown	9729303
NFKB1	Unknown	9729303

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001656	Process	Metanephros development	IEA
GO:0001656	Process	Metanephros development	ISS
GO:0001657	Process	Ureteric bud development	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001755	Process	Neural crest cell migration	IDA	15242795
GO:0001759	Process	Organ induction	IEA
GO:0001941	Process	Postsynaptic membrane organization	IEA
GO:0003337	Process	Mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA
GO:0005102	Function	Signaling receptor binding	TAS	10829012
GO:0005515	Function	Protein binding	IPI	21994944, 23333276, 25416956, 32296183
GO:0005576	Component	Extracellular region	IDA	9811930
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	21994944
GO:0005794	Component	Golgi apparatus	IDA	21994944
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7830769
GO:0007399	Process	Nervous system development	IEA
GO:0007399	Process	Nervous system development	TAS	8637574, 22998873
GO:0007422	Process	Peripheral nervous system development	IBA
GO:0007422	Process	Peripheral nervous system development	IEA
GO:0008083	Function	Growth factor activity	IBA
GO:0008083	Function	Growth factor activity	IDA	8493557, 10829012, 25242331, 31535977
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	22897442
GO:0008344	Process	Adult locomotory behavior	TAS	12358785
GO:0009888	Process	Tissue development	IEA
GO:0010468	Process	Regulation of gene expression	IGI	22897442
GO:0021516	Process	Dorsal spinal cord development	IEA
GO:0021516	Process	Dorsal spinal cord development	ISS
GO:0021784	Process	Postganglionic parasympathetic fiber development	IEA
GO:0021784	Process	Postganglionic parasympathetic fiber development	ISS
GO:0030116	Function	Glial cell-derived neurotrophic factor receptor binding	IEA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030432	Process	Peristalsis	IEA
GO:0030432	Process	Peristalsis	ISS
GO:0030971	Function	Receptor tyrosine kinase binding	IEA
GO:0031175	Process	Neuron projection development	IDA	15242795
GO:0031175	Process	Neuron projection development	TAS	22998873
GO:0033603	Process	Positive regulation of dopamine secretion	TAS	12358785
GO:0035860	Process	Glial cell-derived neurotrophic factor receptor signaling pathway	IDA	25242331, 31535977
GO:0042803	Function	Protein homodimerization activity	IDA	8493557, 8988018
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7830769
GO:0043524	Process	Negative regulation of neuron apoptotic process	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IDA	8493557
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045595	Process	Regulation of cell differentiation	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IGI	22897442
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12358785
GO:0048255	Process	MRNA stabilization	IDA	12358785
GO:0048484	Process	Enteric nervous system development	IEA
GO:0048484	Process	Enteric nervous system development	ISS
GO:0048485	Process	Sympathetic nervous system development	IEA
GO:0048485	Process	Sympathetic nervous system development	ISS
GO:0048513	Process	Animal organ development	IEA
GO:0048568	Process	Embryonic organ development	IEA
GO:0048568	Process	Embryonic organ development	ISS
GO:0051584	Process	Regulation of dopamine uptake involved in synaptic transmission	IDA	8493557
GO:0060676	Process	Ureteric bud formation	IEA
GO:0060688	Process	Regulation of morphogenesis of a branching structure	IEA
GO:0060688	Process	Regulation of morphogenesis of a branching structure	ISS
GO:0061642	Process	Chemoattraction of axon	IEA
GO:0071679	Process	Commissural neuron axon guidance	IEA
GO:0071679	Process	Commissural neuron axon guidance	ISS
GO:0072107	Process	Positive regulation of ureteric bud formation	IDA	8657307
GO:0072108	Process	Positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IBA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IDA	8657307, 17229286
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:1902379	Function	Chemoattractant activity involved in axon guidance	TAS	22998873
GO:2000736	Process	Regulation of stem cell differentiation	TAS	23626767
GO:2001240	Process	Negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA	10921886
GO:2001260	Process	Regulation of semaphorin-plexin signaling pathway	IEA
GO:2001260	Process	Regulation of semaphorin-plexin signaling pathway	ISS

Other IDs

• MIM: 600837
• HGNC: 4232
• e!Ensembl: ENSG00000168621

Protein

• UniProt ID: P39905
• Protein name: Glial cell line-derived neurotrophic factor (hGDNF) (Astrocyte-derived trophic factor) (ATF)
• Protein function: Neurotrophic factor that enhances survival and morphological differentiation of dopaminergic neurons and increases their high-affinity dopamine uptake (PubMed:8493557). Acts by binding to its coreceptor, GFRA1, leading to autophosphorylation and
• PDB: 2V5E, 3FUB, 4UX8, 6Q2N
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00019	TGF_beta	117 → 210	Transforming growth factor beta like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: In the brain, predominantly expressed in the striatum with highest levels in the caudate and lowest in the putamen. Isoform 2 is absent from most tissues except for low levels in intestine and kidney. Highest expression of isoform 3 is
• Sequence:

  MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQ
  FDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVL
  TAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCR
  PIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

• Sequence length: 211

Pathways

KEGG:

MAPK signaling pathway
Calcium signaling pathway
PI3K-Akt signaling pathway

Reactome:

RAF/MAP kinase cascade
RET signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCHS WITH HIRSCHSPRUNG DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CENTRAL HYPOVENTILATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL CENTRAL HYPOVENTILATION SYNDROME	—	CTD, Orphanet CTD, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKINESIA, DRUG-INDUCED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GDNF-related disorder	Likely benign; Benign; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease, Dominant	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung disease, susceptibility to, 1	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung disease, susceptibility to, 3	Benign; Likely benign; risk factor; Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PHEOCHROMOCYTOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acoustic Neuroma	Acoustic Neuroma	BEFREE	19937367		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	BEFREE	25137025, 30975543		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	30335884		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28916425		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	21484932, 22510762, 28930752, 29434341		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25990369		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	10998441, 12139916, 19551609, 22751117, 9215674		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11160720, 8610463		★☆☆☆☆ Found in Text Mining only
Aganglionosis, Colonic	Colonic Aganglionosis	CTD_human_DG	8896568, 8968758		★☆☆☆☆ Found in Text Mining only
Aganglionosis, Rectosigmoid Colon	Colonic Aganglionosis	CTD_human_DG	8896568, 8968758		★☆☆☆☆ Found in Text Mining only
Akinetic-Rigid Variant of Huntington Disease	Akinetic-Rigid Variant Of Huntington Disease	CTD_human_DG	16943855		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19395124, 25253858, 28888073, 29935546	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28918204	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	25119316, 29668503		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10023033, 10202982, 11582516, 11874201, 12177190, 12635522, 15871682, 17668067, 18797452, 19096133, 19322031, 21283077, 22124037, 23712039, 27288458, 27495938, 28276446, 29497380, 29656478, 29706501, 29899726, 9890561		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29706501	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	10446925		★☆☆☆☆ Found in Text Mining only
Anaplastic Ependymoma	Anaplastic Ependymoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28092668		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	24324616		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	24324616	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	24324616, 29906418		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arteriosclerosis	Arteriosclerosis	BEFREE	29991487		★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	37454049	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29577053	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34170009	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10473269, 15138791, 21969113, 26232065, 31310388		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	17244683	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29991487		★☆☆☆☆ Found in Text Mining only
Atherosclerotic Parkinsonism	Atherosclerotic Parkinsonism	CTD_human_DG	19909981		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25523945	Inhibit	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	24324616	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31073917		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31073917		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	15185015	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	30195499		★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	18547788		★☆☆☆☆ Found in Text Mining only
Behavior Disorders	Behavior Disorders	BEFREE	24105724		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	23591579		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28237042		★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	11815973	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	18189280	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	18313696, 24997227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	27772534, 28803094, 28891527		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30521479		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	20888805		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	10408842		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11836564, 12663670, 16050133, 17189429, 17700520, 18089803, 20305694, 22685333, 25141981, 26729199, 28116540, 29297700, 29796165, 30040982		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18628976, 19331149, 19442316, 23650283, 26537518, 26729199, 27592113, 28618963, 29614078, 37061618	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33198803	Inhibit	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	22864788		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	10447463		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	15185015		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	15185015	Associate	★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	19282698, 30923332, 31300484		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	19282698, 22729463	Associate	★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	25692823	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35394699, 35692887, 36041632	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25990369, 31050844		★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	33628594	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29693700, 35394699, 37215991	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	18628976	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11836564, 15870700, 25359574, 26059056, 29575549, 30229828, 30229848, 31420907		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28429654, 29076874, 29434341, 30047065, 31782119, 32720034, 33112109, 33827033, 34251595, 35165059, 37479138	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15386422		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	23056178		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	25234806		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	HPO_DG			★☆☆☆☆ Found in Text Mining only
CCHS WITH HIRSCHSPRUNG DISEASE	Haddad syndrome	CTD_human_DG	9497256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cellular Ependymoma	Ependymoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	15670622, 16146800, 20426902		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11085892, 11102581, 15670622, 16146800, 20888805, 28819313, 29497380		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	29023897, 30790638		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	29023897, 30790638		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21972289		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25502636	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	19399830		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	17786276, 29496177		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25234806		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	BEFREE	10766345, 11063792, 11064357, 11709699, 11826187, 12966428, 15588860, 15712185, 15884099, 16021514, 16258500, 16327442, 16517477, 16766266, 16878328, 17000668, 17096732, 17724745, 18094413, 18300804, 18408594, 19500183, 19561568, 20087159, 21185830, 22559980, 22886438, 23228147, 23281395, 23410975, 23953591, 25880253, 27719746, 31139520, 31488818, 7753552, 8223458, 8401579, 8552387, 9160316, 9247632, 9546434, 9569031		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	LHGDN	11992546		★☆☆☆☆ Found in Text Mining only
Clear Cell Sarcoma of Soft Tissue	Sarcoma	ORPHANET_DG	19561568		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30763583		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	19395124	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	28888073	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21235736	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21830274, 24118792	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24165321		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22819556, 22852817, 26553438, 29888107, 30026326, 30383193, 30811036, 30885929, 31204011, 31799611		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22631637, 23737956, 26553438, 28540987, 29453334, 29727690, 30383193, 31341364, 33858496, 34698107, 36200182, 37237279, 37816820	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	12914250, 7854063		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	BEFREE	31819204		★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	24642655, 29420729		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	21490379		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	21490379		★☆☆☆☆ Found in Text Mining only
Congenital anomaly of the kidney	Multicystic renal dysplasia	BEFREE	18252215		★☆☆☆☆ Found in Text Mining only
Congenital central hypoventilation	Congenital Central Hypoventilation	UNIPROT_DG	9497256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital central hypoventilation	Congenital Central Hypoventilation	CTD_human_DG	9497256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital central hypoventilation	Congenital Central Hypoventilation	ORPHANET_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital central hypoventilation	Congenital Central Hypoventilation	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Intestinal Aganglionosis	Congenital Intestinal Aganglionosis	CTD_human_DG	8896568, 8968758		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27377902		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21235736	Inhibit	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	24223725		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	25041846		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	15712185, 19561646, 22189301		★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	12165857		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27821620		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	11592846		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	11592846		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	25737042		★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	31456664		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	14647483, 22152193, 24022000, 24324616, 25689572, 28099138, 28689143, 28819313, 28878618, 29787856, 30089897, 30445385		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	28819313	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	28819313	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29740907, 31829413		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29740907, 31829413		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37754589	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32993798	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31509462		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	17470563, 30576241		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	17470563		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	30797114		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	23805210, 28152033, 31019703		★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular disease	Pubtator	23805210, 28152033	Inhibit	★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular disease	Pubtator	31019703	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinesia, Drug-Induced	Dyskinesia	CTD_human_DG	11168568		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30073506		★☆☆☆☆ Found in Text Mining only
Ehlers-Danlos Syndrome	Ehlers-Danlos Syndrome	BEFREE	31784499		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31678095		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	29608602, 29614078, 36765275	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20087603	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	27041028	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30251099		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	15138791		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Epilepsies, Partial	Epilepsy	BEFREE	30464254		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30665947, 31181430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epiretinal Membrane	Epiretinal Membrane	BEFREE	12032115		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28912415	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	26149214		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	26149214	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	10766345, 12966428, 30642852, 7753552, 9160316, 9546434		★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25502636		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	15753368, 9681515		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	26564715		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36613525	Inhibit	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26564715, 31171625, 31418419		★☆☆☆☆ Found in Text Mining only
Fraser Syndrome	Fraser syndrome	Pubtator	29197384	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26337663	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	31019703		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	15712185		★☆☆☆☆ Found in Text Mining only
Giant Cell Glioblastoma	Giant Cell Glioblastoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	26096985		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	12813408	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28259830		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10672319, 18794154, 19138852, 23344256, 28878618, 29088765, 30176167, 9972821		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	CTD_human_DG	19138852		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	Pubtator	20547774, 27588402, 30176167, 32183903	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma Multiforme	Glioblastoma	BEFREE	18794154, 19138852, 23344256, 28878618, 29088765, 30059726, 30176167, 9972821		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10077155, 10672319, 20615395, 23344256, 23606280, 25258251, 28187447, 28212546, 29088765, 29224008, 29750313, 30059726, 30695072		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	17012236, 28212546, 35894143	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	19138852		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	29224008, 30695072	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis	Glomerulonephritis	BEFREE	22105543		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulonephritis IGA	Iga nephropathy	Pubtator	38301615	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	22729463	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	12914250, 7854063		★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	10426588		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21990224, 25036711		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	21990224	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	23966864		★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	35245485	Stimulate	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	22052915	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	35855954	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	16081212		★☆☆☆☆ Found in Text Mining only
Hereditary Paraganglioma-Pheochromocytoma Syndrome	Hereditary Paraganglioma-Pheochromocytoma Syndromes	CLINGEN_DG	9215674		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	10204848, 10591552, 10812967, 10859088, 10978357, 11371032, 11823451, 11973622, 12065680, 12086152, 12720173, 18970938, 19183406, 19282698, 20110328, 20456320, 21206993, 21858136, 23512482, 23805210, 8896568, 8896569, 8968758, 9215674, 9465906, 9473110, 9545641, 9681515, 9721987, 9745455, 9760196		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease	Hirschsprung disease	Pubtator	10204848, 10978357, 12065680, 19282698, 19925665, 21858136, 23805210	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease	Hirschsprung Disease	LHGDN	11823451, 19183406		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung disease	Hirschsprung Disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease	Hirschsprung Disease	CTD_human_DG	8896568, 8968758		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Histiocytoma Angiomatoid Fibrous	Angiomatoid fibrous histiocytoma	Pubtator	19801966, 21822206, 30642852, 34193943, 34228212	Associate	★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	11063792, 12218455, 12915480, 15884099, 17188428, 17724745, 18094413, 18300800, 21822206, 22510762, 24043718, 25804255, 25927151, 28009602, 30642852, 30819530		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11091852		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21385932	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	15817265, 15878807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	16751280, 22081608, 27236019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	CTD_human_DG	16943855		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease, Late Onset	Huntington Disease	CTD_human_DG	16943855		★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	16453021		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	Pubtator	29983117	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29393223, 30905258		★☆☆☆☆ Found in Text Mining only
Hypertensive Retinopathy	Hypertensive Retinopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	21227937		★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	12721254		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28213636, 28342945, 28918204, 29114922, 31420036		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26294673	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27151942, 31205031		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36613525	Inhibit	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35784175	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	35784175	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	31520444		★☆☆☆☆ Found in Text Mining only
Intestinal Obstruction	Intestinal Obstruction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Polyposis	Intestinal Polyposis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intestinal Pseudo-Obstruction	Intestinal Pseudoobstruction	BEFREE	16453021		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29178939		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30413627, 31188015		★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	CTD_human_DG	16943855		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18252215, 36408280	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33112109	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11238126	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23474756, 28203711, 31537905, 9108413	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12915480, 28203711		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Li-Fraumeni Syndrome	Li-Fraumeni Syndrome	BEFREE	15526362		★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	25749382		★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	25749382		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	25749382		★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	11063792, 12915480		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24968707, 25096061, 26675549, 28772210, 29693700, 30376856		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27821620		★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	11836564		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21901137, 25359574, 30229848	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	15490235		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	35397606	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23416976, 29496177		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	33883344	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15185015		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18313696, 21223624, 22152193, 24577123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	22152193, 24577123, 27219347, 28819313, 29898192, 29945425, 30445385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	27716965, 29712778		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	19138852, 28187447, 28212546		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25036711		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	28505004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11836564, 16050133, 17189429, 17700520, 18089803, 22685333, 25141981, 26729199, 27602955, 28116540, 29297700, 29796165, 30040982		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	24968707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11836564, 15870700, 25359574, 26059056, 29575549, 30229828, 30229848, 31420907		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15386422		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10077155, 12947332, 15211107, 16269310, 22109562, 28318081, 29453972, 31799611		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19047143, 25575823, 28237042, 28337266, 28490466, 29996942		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17409099, 22751117		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11062705, 11642609, 12027462, 15920519, 16475943, 18348191, 20029425, 20068194, 24165321, 24378390, 24778213, 25359574, 26851004, 28092668, 28237042, 28878618, 29147602, 29245123, 30521479, 30666215, 30696076, 31204011, 31799611		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	23591579		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	29023897, 30790638		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24165321		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11836564, 12734209		★☆☆☆☆ Found in Text Mining only
Mandibular Neoplasms	Mandibular Neoplasms	BEFREE	28559020		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	31574363		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	9600247		★☆☆☆☆ Found in Text Mining only
Medullary nephrocalcinosis	Medullary nephrocalcinosis	BEFREE	29208768		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10318823, 12789291, 15010535, 15312676, 15523674, 15531295, 15712185, 16285301, 16306050, 16766266, 16878328, 18300804, 18408594, 18677098, 19561646, 19620941, 20087159, 20422010, 21147226, 21203491, 22275354, 22685333, 23589174, 24968707, 25728676, 26462148, 26645581, 27210757, 30497386, 9484842		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10318823, 18397884, 19884546, 20087159, 22304920, 25728676, 38294692	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	14678960		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	19561646, 22189301	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma of soft tissue	Melanoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Memory dysfunction	Memory Disorders	BEFREE	28213636		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	14647483, 22152193, 24022000, 24324616, 25689572, 28099138, 28689143, 28819313, 28878618, 29787856, 30089897, 30445385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	24324616, 28342945, 28891527		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	30464254		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	34193943, 35665561	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	28505004, 34121509	Associate	★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15712185, 16878328, 23589174		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30264295		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	25737042, 31650626		★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Astrocytoma	Mixed Oligodendroglioma-Astrocytoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Mixed Oligodendroglioma-Ependymoma	Mixed Oligodendroglioma-Ependymoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28099138		★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	27288458		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	10447463, 10797554, 11436355, 12177190, 12645079, 27288458		★☆☆☆☆ Found in Text Mining only
Mouth Abnormalities	Mouth Abnormalities	HPO_DG			★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	26611606		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia	Multiple Endocrine Neoplasia	BEFREE	11360177, 22189301		★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	17555548, 9681515, 9745455		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	11979448, 12630912, 9681515, 9745455		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26433312	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	21152067	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	24469912		★☆☆☆☆ Found in Text Mining only
MYOPATHY, MYOFIBRILLAR, DESMIN-RELATED	Myofibrillar myopathy	BEFREE	27941998		★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	11063792, 12915480		★☆☆☆☆ Found in Text Mining only
Myxopapillary ependymoma	Myxopapillary Ependymoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	BEFREE	30711515		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	18931081, 28032861, 30905073		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	30905073	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10426588, 10728700, 10851072, 11642609, 11709699, 11836564, 12630912, 12679485, 15138791, 15312676, 15490235, 15712185, 15884099, 16306050, 16355116, 17189429, 17409099, 17700520, 18089803, 1829805, 18677098, 20087159, 20422010, 20581861, 20858484, 21185830, 21203491, 21484932, 22510762, 22685333, 23410975, 24289970, 25137025, 25141981, 25456131, 25575823, 25728676, 26163185, 26462148, 27377902, 27602955, 28009602, 28116540, 28318081, 28946910, 29076874, 29297700, 29975250, 30521479, 30790638, 7753552, 9000574, 9215674, 9484842		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	23591579		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10749116		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	14686749	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	BEFREE	30642852		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10473269, 10869820, 11836564, 12358785, 12485836, 12914961, 14580940, 14687604, 15207709, 15314161, 19320641, 21969113, 25119316, 28878618, 29262623, 31720997, 9299438, 9972821		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	11836564		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12358785, 12914961, 17388787, 19320641, 19633294, 8798576	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	26215053, 30711515, 32993798	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10978846, 17023388, 22081608, 28096470, 30341696, 30711515, 31827666, 9811930		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	11592846		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	15878807, 17023388		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	9284737		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	LHGDN	11565554		★☆☆☆☆ Found in Text Mining only
Neuroma	Neuroma	BEFREE	18585464		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular Diseases	BEFREE	10202982, 29307828, 29899726		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	11360269, 28033318		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	26564715, 29298863		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	12914250, 7854063		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	LHGDN	15870700		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20530713, 25359574, 26935060, 28259977, 29850528, 30229828, 30229848		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29298863		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26119994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	29906418		★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 1B	Oculocutaneous albinism	Pubtator	25913759	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30040982		★☆☆☆☆ Found in Text Mining only
Oligodendroblastoma	Oligodendroblastoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	CTD_human_DG	19138852		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ondine syndrome	Ondine Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	23866832, 34856957	Associate	★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	BEFREE	29712778		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30809532	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28281638, 30816442		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	30816442, 32587775	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15386422		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10077155, 12947332, 15211107, 20068194, 22109562, 28318081, 29453972, 31799611		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12947332, 15211107, 18652760		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18652760, 22109562, 23270819, 32438692	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	29906418		★☆☆☆☆ Found in Text Mining only
Papillary ependymoma	Papillary Ependymoma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17409099		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	10998441		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10634236, 10646649, 10945767, 10978846, 11124990, 11128607, 11529246, 11549061, 11825297, 12031276, 12075987, 12480187, 12666104, 14499199, 14687604, 15474365, 15480595, 15934841, 16307601, 16519007, 16644101, 17065462, 17164776, 18061591, 18436345, 18586376, 19254173, 19349823, 19639608, 19860652, 20350486, 20369355, 20518608, 20544825, 21147986, 21357726, 21712347, 21838676, 22086235, 23029456, 23390096, 23881415, 23934644, 24312503, 24324616, 24473149, 24635742, 25325362, 25771799, 26176331, 26611606, 26616211, 26681446, 27012974, 27286696, 27425888, 27607574, 27616425, 27928963, 28130107, 28219741, 28247332, 28276446, 28346830, 28493093, 28511006, 28553325, 28611284, 28826718, 28866799, 28880247, 29113462, 29240240, 29377238, 29562865, 29588162, 29615705, 29686604, 29701077, 29779176, 29785638, 29802278, 29857941, 29858093, 29959908, 29973907, 30059726, 30076831, 30089897, 30531868, 30808022, 30829619, 30877973, 30947516, 30984255, 31004735, 31033033, 31119595, 31310388, 31495777, 31538765, 31644786, 31650626, 31669104, 31678095, 31820346, 31840869, 8493557, 9012352, 9013392, 9391156, 9449424, 9593897, 9710530, 9878166, 9890561		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	11031079, 16324109		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	12882651, 20395301, 24324616, 25061293, 29706501, 33935108, 40395017	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	15878807		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	36768317	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	31538765		★☆☆☆☆ Found in Text Mining only
Parkinson Disease, Secondary Vascular	Parkinson Disease	CTD_human_DG	19909981		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	12213621, 9266731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	BEFREE	16307601, 24997241, 29615705		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
Paroxysmal hypertension	Paroxysmal Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paroxysmal nocturnal hemoglobinuria	Paroxysmal nocturnal hemoglobinuria	BEFREE	28630090		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Peripheral nervous system disease	Pubtator	30648113	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	9853108		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	35665561	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31073917		★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	12914250, 7854063		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	10998441, 12139916, 19551609, 22751117, 9215674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	CTD_human_DG	9215674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	UNIPROT_DG	9215674		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma	Pheochromocytoma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pheochromocytoma, Extra-Adrenal	Extra-Adrenal Pheochromocytoma	CTD_human_DG	9215674		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15658002, 15977985		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	12032115, 29084332, 29095861, 30576241		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	25137025		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	16049073		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	16049073		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	LHGDN	16049073		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29906418		★☆☆☆☆ Found in Text Mining only
Posteriorly rotated ear	Posteriorly Rotated Ear	HPO_DG			★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	28479419		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	25737042		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	10426588		★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	29084332		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19047143, 25575823, 28237042, 28337266, 28490466, 29996942		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18397884, 19047143, 25575823, 29996942	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31215034		★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	12213621, 9266731		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	28341395		★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	21490379		★☆☆☆☆ Found in Text Mining only
Renal Artery Stenosis	Renal Artery Stenosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27377902		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30497277		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	10364225		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	24593181		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	28918204		★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	28918204	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10943860, 17530707, 28341395, 29372349, 30728072		★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	30464254		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	27769871		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	29076874	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12721254, 15884099, 22510762, 23281395, 24946937, 29491075, 31488818		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	16327442		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	31232935, 34193943	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	10574952, 11826187, 12966428, 16867224, 19561568, 20087159, 25880253, 30219084, 31232935, 33478436, 34193943, 34228212, 35476996, 35477713, 36041632, 36959380, 37405123	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	12966428, 30642852, 36041632, 8223458	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	BEFREE	24289970		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11600185, 15003293, 17897812, 20116071, 24022000, 24324616, 28314679, 28342945, 28689143, 29444518, 29901253, 31420036		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	15003293, 17897812, 20116071, 24022000		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	17897812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24324616	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sclerocystic Ovaries	Sclerocystic Ovaries	CTD_human_DG	21411543		★☆☆☆☆ Found in Text Mining only
Secondary Parkinson Disease	Parkinson disease	CTD_human_DG	19909981		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seminoma	Seminoma	BEFREE	20201982		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29307828		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	14623261		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30481683		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	18677098, 22685333		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	22304920	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	20538960, 33530245, 33688499	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	33688499	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	20538960		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	9559344		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	24289970		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18547788		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21990224	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21990224, 29147602		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	12914250, 7854063		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	12914250, 7854063		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	26564715		★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	12721254		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19375421, 34195276, 35397606, 36615849, 36808605	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	28819313	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	22439931, 24289970		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	15185015		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	23473982		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	20201982		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	20201982		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	33724979	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17409099, 21333695, 22751117		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	17409099, 22751117		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	17409099	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	32597152	Inhibit	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	26096985	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34326372	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	18313696, 21223624, 22152193, 24577123		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	BEFREE	22152193, 28819313, 29945425, 30445385		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urogenital Abnormalities	Urogenital Abnormalities	BEFREE	9600247		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25830725, 31204513	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34983301, 35245485	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	CTD_human_DG	19138852		★☆☆☆☆ Found in Text Mining only