Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	2664
Gene name	GDP dissociation inhibitor 1
Gene symbol	GDI1
Synonyms (NCBI Gene)	1AGDILMRX41MRX48OPHN2RABGD1ARABGDIAXAP-4XLID41
Chromosome	X
Chromosome location	Xq28
Summary	GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434607	T>C	Pathogenic	Coding sequence variant, missense variant
rs121434608	C>T	Pathogenic	Coding sequence variant, stop gained
rs1557198566	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1557198821	G>A	Likely-pathogenic	Splice donor variant

471

Show/Hide all (471)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025345	hsa-miR-34a-5p	Proteomics	21566225
MIRT025345	hsa-miR-34a-5p	Proteomics	21566225
MIRT025345	hsa-miR-34a-5p	Proteomics	21566225
MIRT025345	hsa-miR-34a-5p	Proteomics	21566225
MIRT029357	hsa-miR-26b-5p	Microarray	19088304
MIRT046698	hsa-miR-222-3p	CLASH	23622248
MIRT366309	hsa-miR-4687-5p	PAR-CLIP	20371350
MIRT366315	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT508527	hsa-miR-3131	PAR-CLIP	20371350
MIRT508526	hsa-miR-611	PAR-CLIP	20371350
MIRT366294	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT366296	hsa-miR-151b	PAR-CLIP	20371350
MIRT366298	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT366302	hsa-miR-3605-5p	PAR-CLIP	20371350
MIRT366312	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT366306	hsa-miR-3135b	PAR-CLIP	20371350
MIRT508525	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT366313	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT508524	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT508523	hsa-miR-1292-5p	PAR-CLIP	20371350
MIRT366301	hsa-miR-4271	PAR-CLIP	20371350
MIRT366310	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT366314	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT366295	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT508520	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT508519	hsa-miR-5698	PAR-CLIP	20371350
MIRT508518	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT508516	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT508517	hsa-miR-4525	PAR-CLIP	20371350
MIRT508515	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT379658	hsa-miR-541-3p	PAR-CLIP	20371350
MIRT379657	hsa-miR-654-5p	PAR-CLIP	20371350
MIRT366293	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT379666	hsa-miR-6769a-5p	PAR-CLIP	20371350
MIRT379668	hsa-miR-6769b-5p	PAR-CLIP	20371350
MIRT366305	hsa-miR-4447	PAR-CLIP	20371350
MIRT366307	hsa-miR-4472	PAR-CLIP	20371350
MIRT366299	hsa-miR-1275	PAR-CLIP	20371350
MIRT366308	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT366309	hsa-miR-4687-5p	PAR-CLIP	23446348
MIRT366315	hsa-miR-6847-5p	PAR-CLIP	23446348
MIRT508527	hsa-miR-3131	PAR-CLIP	23446348
MIRT508526	hsa-miR-611	PAR-CLIP	23446348
MIRT366294	hsa-miR-151a-5p	PAR-CLIP	23446348
MIRT366296	hsa-miR-151b	PAR-CLIP	23446348
MIRT366298	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT366302	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT366312	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT366306	hsa-miR-3135b	PAR-CLIP	23446348
MIRT508525	hsa-miR-1287-5p	PAR-CLIP	23446348
MIRT366313	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT508524	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT508523	hsa-miR-1292-5p	PAR-CLIP	23446348
MIRT508522	hsa-miR-4471	PAR-CLIP	23446348
MIRT508521	hsa-miR-8059	PAR-CLIP	23446348
MIRT366301	hsa-miR-4271	PAR-CLIP	23446348
MIRT366310	hsa-miR-4725-3p	PAR-CLIP	23446348
MIRT366314	hsa-miR-6780b-5p	PAR-CLIP	23446348
MIRT366295	hsa-miR-625-5p	PAR-CLIP	23446348
MIRT508520	hsa-miR-4723-5p	PAR-CLIP	23446348
MIRT508519	hsa-miR-5698	PAR-CLIP	23446348
MIRT508518	hsa-miR-6870-5p	PAR-CLIP	23446348
MIRT508516	hsa-miR-7111-5p	PAR-CLIP	23446348
MIRT508517	hsa-miR-4525	PAR-CLIP	23446348
MIRT508515	hsa-miR-5010-5p	PAR-CLIP	23446348
MIRT379658	hsa-miR-541-3p	PAR-CLIP	23446348
MIRT379657	hsa-miR-654-5p	PAR-CLIP	23446348
MIRT366293	hsa-miR-92a-2-5p	PAR-CLIP	23446348
MIRT366305	hsa-miR-4447	PAR-CLIP	23446348
MIRT366307	hsa-miR-4472	PAR-CLIP	23446348
MIRT366299	hsa-miR-1275	PAR-CLIP	23446348
MIRT366308	hsa-miR-4665-5p	PAR-CLIP	23446348
MIRT366301	hsa-miR-4271	PAR-CLIP	26701625
MIRT366305	hsa-miR-4447	PAR-CLIP	26701625
MIRT366307	hsa-miR-4472	PAR-CLIP	26701625
MIRT366310	hsa-miR-4725-3p	PAR-CLIP	26701625
MIRT366295	hsa-miR-625-5p	PAR-CLIP	26701625
MIRT366314	hsa-miR-6780b-5p	PAR-CLIP	26701625
MIRT366293	hsa-miR-92a-2-5p	PAR-CLIP	26701625
MIRT366301	hsa-miR-4271	PAR-CLIP	27292025
MIRT366310	hsa-miR-4725-3p	PAR-CLIP	27292025
MIRT366295	hsa-miR-625-5p	PAR-CLIP	27292025
MIRT366314	hsa-miR-6780b-5p	PAR-CLIP	27292025
MIRT736743	hsa-miR-483-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)qRT-PCRIn situ hybridizationin vivo gain/loss-of-function experiments	24710410
MIRT366309	hsa-miR-4687-5p	PAR-CLIP	20371350
MIRT366315	hsa-miR-6847-5p	PAR-CLIP	20371350
MIRT508527	hsa-miR-3131	PAR-CLIP	20371350
MIRT508526	hsa-miR-611	PAR-CLIP	20371350
MIRT366294	hsa-miR-151a-5p	PAR-CLIP	20371350
MIRT366296	hsa-miR-151b	PAR-CLIP	20371350
MIRT366298	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT366302	hsa-miR-3605-5p	PAR-CLIP	20371350
MIRT366312	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT366306	hsa-miR-3135b	PAR-CLIP	20371350
MIRT508525	hsa-miR-1287-5p	PAR-CLIP	20371350
MIRT366313	hsa-miR-6828-5p	PAR-CLIP	20371350
MIRT508524	hsa-miR-505-5p	PAR-CLIP	20371350
MIRT508523	hsa-miR-1292-5p	PAR-CLIP	20371350
MIRT366301	hsa-miR-4271	PAR-CLIP	20371350
MIRT366310	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT366314	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT366295	hsa-miR-625-5p	PAR-CLIP	20371350
MIRT508520	hsa-miR-4723-5p	PAR-CLIP	20371350
MIRT508519	hsa-miR-5698	PAR-CLIP	20371350
MIRT508518	hsa-miR-6870-5p	PAR-CLIP	20371350
MIRT508516	hsa-miR-7111-5p	PAR-CLIP	20371350
MIRT508517	hsa-miR-4525	PAR-CLIP	20371350
MIRT508515	hsa-miR-5010-5p	PAR-CLIP	20371350
MIRT379658	hsa-miR-541-3p	PAR-CLIP	20371350
MIRT379657	hsa-miR-654-5p	PAR-CLIP	20371350
MIRT366293	hsa-miR-92a-2-5p	PAR-CLIP	20371350
MIRT379666	hsa-miR-6769a-5p	PAR-CLIP	20371350
MIRT379668	hsa-miR-6769b-5p	PAR-CLIP	20371350
MIRT366305	hsa-miR-4447	PAR-CLIP	20371350
MIRT366307	hsa-miR-4472	PAR-CLIP	20371350
MIRT366299	hsa-miR-1275	PAR-CLIP	20371350
MIRT366308	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT366309	hsa-miR-4687-5p	PAR-CLIP	23446348
MIRT366315	hsa-miR-6847-5p	PAR-CLIP	23446348
MIRT508527	hsa-miR-3131	PAR-CLIP	23446348
MIRT508526	hsa-miR-611	PAR-CLIP	23446348
MIRT366294	hsa-miR-151a-5p	PAR-CLIP	23446348
MIRT366296	hsa-miR-151b	PAR-CLIP	23446348
MIRT366298	hsa-miR-1233-3p	PAR-CLIP	23446348
MIRT366302	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT366312	hsa-miR-2467-3p	PAR-CLIP	23446348
MIRT366306	hsa-miR-3135b	PAR-CLIP	23446348
MIRT508525	hsa-miR-1287-5p	PAR-CLIP	23446348
MIRT366313	hsa-miR-6828-5p	PAR-CLIP	23446348
MIRT508524	hsa-miR-505-5p	PAR-CLIP	23446348
MIRT508523	hsa-miR-1292-5p	PAR-CLIP	23446348
MIRT508522	hsa-miR-4471	PAR-CLIP	23446348
MIRT508521	hsa-miR-8059	PAR-CLIP	23446348
MIRT366301	hsa-miR-4271	PAR-CLIP	23446348
MIRT366310	hsa-miR-4725-3p	PAR-CLIP	23446348
MIRT366314	hsa-miR-6780b-5p	PAR-CLIP	23446348
MIRT366295	hsa-miR-625-5p	PAR-CLIP	23446348
MIRT508520	hsa-miR-4723-5p	PAR-CLIP	23446348
MIRT508519	hsa-miR-5698	PAR-CLIP	23446348
MIRT508518	hsa-miR-6870-5p	PAR-CLIP	23446348
MIRT508516	hsa-miR-7111-5p	PAR-CLIP	23446348
MIRT508517	hsa-miR-4525	PAR-CLIP	23446348
MIRT508515	hsa-miR-5010-5p	PAR-CLIP	23446348
MIRT379658	hsa-miR-541-3p	PAR-CLIP	23446348
MIRT379657	hsa-miR-654-5p	PAR-CLIP	23446348
MIRT366293	hsa-miR-92a-2-5p	PAR-CLIP	23446348
MIRT366305	hsa-miR-4447	PAR-CLIP	23446348
MIRT366307	hsa-miR-4472	PAR-CLIP	23446348
MIRT366299	hsa-miR-1275	PAR-CLIP	23446348
MIRT366308	hsa-miR-4665-5p	PAR-CLIP	23446348
MIRT1015760	hsa-miR-1207-5p	CLIP-seq
MIRT1015761	hsa-miR-1224-3p	CLIP-seq
MIRT1015762	hsa-miR-1237	CLIP-seq
MIRT1015763	hsa-miR-1238	CLIP-seq
MIRT1015764	hsa-miR-1248	CLIP-seq
MIRT1015765	hsa-miR-1260	CLIP-seq
MIRT1015766	hsa-miR-1260b	CLIP-seq
MIRT1015767	hsa-miR-1280	CLIP-seq
MIRT1015768	hsa-miR-1287	CLIP-seq
MIRT1015769	hsa-miR-139-5p	CLIP-seq
MIRT1015770	hsa-miR-140-3p	CLIP-seq
MIRT1015771	hsa-miR-1468	CLIP-seq
MIRT1015772	hsa-miR-181a	CLIP-seq
MIRT1015773	hsa-miR-181b	CLIP-seq
MIRT1015774	hsa-miR-181c	CLIP-seq
MIRT1015775	hsa-miR-181d	CLIP-seq
MIRT1015776	hsa-miR-188-3p	CLIP-seq
MIRT1015777	hsa-miR-1909	CLIP-seq
MIRT1015778	hsa-miR-2110	CLIP-seq
MIRT1015779	hsa-miR-2113	CLIP-seq
MIRT1015780	hsa-miR-214	CLIP-seq
MIRT1015781	hsa-miR-218	CLIP-seq
MIRT1015782	hsa-miR-224	CLIP-seq
MIRT1015783	hsa-miR-24	CLIP-seq
MIRT1015784	hsa-miR-296-5p	CLIP-seq
MIRT1015785	hsa-miR-3127-3p	CLIP-seq
MIRT1015786	hsa-miR-3156-3p	CLIP-seq
MIRT1015787	hsa-miR-3170	CLIP-seq
MIRT1015788	hsa-miR-3179	CLIP-seq
MIRT1015789	hsa-miR-3192	CLIP-seq
MIRT1015790	hsa-miR-3202	CLIP-seq
MIRT1015791	hsa-miR-3619-5p	CLIP-seq
MIRT1015792	hsa-miR-3622b-5p	CLIP-seq
MIRT1015793	hsa-miR-3675-5p	CLIP-seq
MIRT1015794	hsa-miR-3689a-3p	CLIP-seq
MIRT1015795	hsa-miR-3689c	CLIP-seq
MIRT1015796	hsa-miR-3910	CLIP-seq
MIRT1015797	hsa-miR-4262	CLIP-seq
MIRT1015798	hsa-miR-4284	CLIP-seq
MIRT1015799	hsa-miR-4438	CLIP-seq
MIRT1015800	hsa-miR-4446-5p	CLIP-seq
MIRT1015801	hsa-miR-4457	CLIP-seq
MIRT1015802	hsa-miR-4488	CLIP-seq
MIRT1015803	hsa-miR-4492	CLIP-seq
MIRT1015804	hsa-miR-4498	CLIP-seq
MIRT1015805	hsa-miR-4505	CLIP-seq
MIRT1015806	hsa-miR-4509	CLIP-seq
MIRT1015807	hsa-miR-450b-5p	CLIP-seq
MIRT1015808	hsa-miR-4652-3p	CLIP-seq
MIRT1015809	hsa-miR-4677-3p	CLIP-seq
MIRT1015810	hsa-miR-4679	CLIP-seq
MIRT1015811	hsa-miR-4691-5p	CLIP-seq
MIRT1015812	hsa-miR-4696	CLIP-seq
MIRT1015813	hsa-miR-4697-5p	CLIP-seq
MIRT1015814	hsa-miR-4704-5p	CLIP-seq
MIRT1015815	hsa-miR-4717-5p	CLIP-seq
MIRT1015816	hsa-miR-4728-5p	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015818	hsa-miR-4731-5p	CLIP-seq
MIRT1015819	hsa-miR-4747-5p	CLIP-seq
MIRT1015820	hsa-miR-4753-5p	CLIP-seq
MIRT1015821	hsa-miR-4763-3p	CLIP-seq
MIRT1015822	hsa-miR-4768-5p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT1015824	hsa-miR-486-3p	CLIP-seq
MIRT1015825	hsa-miR-491-5p	CLIP-seq
MIRT1015826	hsa-miR-515-5p	CLIP-seq
MIRT1015827	hsa-miR-545	CLIP-seq
MIRT1015828	hsa-miR-548an	CLIP-seq
MIRT1015829	hsa-miR-555	CLIP-seq
MIRT1015830	hsa-miR-625	CLIP-seq
MIRT1015831	hsa-miR-642b	CLIP-seq
MIRT1015832	hsa-miR-761	CLIP-seq
MIRT1015833	hsa-miR-762	CLIP-seq
MIRT1015834	hsa-miR-942	CLIP-seq
MIRT1556445	hsa-miR-3125	CLIP-seq
MIRT1556446	hsa-miR-3914	CLIP-seq
MIRT1556447	hsa-miR-3916	CLIP-seq
MIRT1556448	hsa-miR-3928	CLIP-seq
MIRT1556449	hsa-miR-4428	CLIP-seq
MIRT1015801	hsa-miR-4457	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015818	hsa-miR-4731-5p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT1015830	hsa-miR-625	CLIP-seq
MIRT1015760	hsa-miR-1207-5p	CLIP-seq
MIRT1015761	hsa-miR-1224-3p	CLIP-seq
MIRT1015763	hsa-miR-1238	CLIP-seq
MIRT1015765	hsa-miR-1260	CLIP-seq
MIRT1015766	hsa-miR-1260b	CLIP-seq
MIRT1015767	hsa-miR-1280	CLIP-seq
MIRT2000738	hsa-miR-133a	CLIP-seq
MIRT2000739	hsa-miR-133b	CLIP-seq
MIRT1015770	hsa-miR-140-3p	CLIP-seq
MIRT1015772	hsa-miR-181a	CLIP-seq
MIRT1015773	hsa-miR-181b	CLIP-seq
MIRT1015774	hsa-miR-181c	CLIP-seq
MIRT1015775	hsa-miR-181d	CLIP-seq
MIRT1015776	hsa-miR-188-3p	CLIP-seq
MIRT1015777	hsa-miR-1909	CLIP-seq
MIRT1015780	hsa-miR-214	CLIP-seq
MIRT1015786	hsa-miR-3156-3p	CLIP-seq
MIRT1015788	hsa-miR-3179	CLIP-seq
MIRT2000740	hsa-miR-3180	CLIP-seq
MIRT2000741	hsa-miR-3180-3p	CLIP-seq
MIRT2000742	hsa-miR-3196	CLIP-seq
MIRT1015790	hsa-miR-3202	CLIP-seq
MIRT1015791	hsa-miR-3619-5p	CLIP-seq
MIRT1015792	hsa-miR-3622b-5p	CLIP-seq
MIRT1015793	hsa-miR-3675-5p	CLIP-seq
MIRT2000743	hsa-miR-3681	CLIP-seq
MIRT1015796	hsa-miR-3910	CLIP-seq
MIRT1015797	hsa-miR-4262	CLIP-seq
MIRT1015799	hsa-miR-4438	CLIP-seq
MIRT2000744	hsa-miR-4477b	CLIP-seq
MIRT1015802	hsa-miR-4488	CLIP-seq
MIRT1015803	hsa-miR-4492	CLIP-seq
MIRT1015804	hsa-miR-4498	CLIP-seq
MIRT1015805	hsa-miR-4505	CLIP-seq
MIRT1015806	hsa-miR-4509	CLIP-seq
MIRT1015807	hsa-miR-450b-5p	CLIP-seq
MIRT1015808	hsa-miR-4652-3p	CLIP-seq
MIRT1015809	hsa-miR-4677-3p	CLIP-seq
MIRT1015810	hsa-miR-4679	CLIP-seq
MIRT1015811	hsa-miR-4691-5p	CLIP-seq
MIRT1015812	hsa-miR-4696	CLIP-seq
MIRT2000745	hsa-miR-4697-3p	CLIP-seq
MIRT1015813	hsa-miR-4697-5p	CLIP-seq
MIRT1015815	hsa-miR-4717-5p	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015818	hsa-miR-4731-5p	CLIP-seq
MIRT1015819	hsa-miR-4747-5p	CLIP-seq
MIRT1015821	hsa-miR-4763-3p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT1015824	hsa-miR-486-3p	CLIP-seq
MIRT1015827	hsa-miR-545	CLIP-seq
MIRT1015828	hsa-miR-548an	CLIP-seq
MIRT1015830	hsa-miR-625	CLIP-seq
MIRT2000746	hsa-miR-637	CLIP-seq
MIRT1015831	hsa-miR-642b	CLIP-seq
MIRT1015832	hsa-miR-761	CLIP-seq
MIRT1015833	hsa-miR-762	CLIP-seq
MIRT1015760	hsa-miR-1207-5p	CLIP-seq
MIRT1015761	hsa-miR-1224-3p	CLIP-seq
MIRT2234212	hsa-miR-1233	CLIP-seq
MIRT1015765	hsa-miR-1260	CLIP-seq
MIRT1015766	hsa-miR-1260b	CLIP-seq
MIRT2234213	hsa-miR-1262	CLIP-seq
MIRT1015767	hsa-miR-1280	CLIP-seq
MIRT1015768	hsa-miR-1287	CLIP-seq
MIRT2234214	hsa-miR-1292	CLIP-seq
MIRT1015770	hsa-miR-140-3p	CLIP-seq
MIRT2234215	hsa-miR-151-5p	CLIP-seq
MIRT1015772	hsa-miR-181a	CLIP-seq
MIRT1015773	hsa-miR-181b	CLIP-seq
MIRT1015774	hsa-miR-181c	CLIP-seq
MIRT1015775	hsa-miR-181d	CLIP-seq
MIRT1015776	hsa-miR-188-3p	CLIP-seq
MIRT1015777	hsa-miR-1909	CLIP-seq
MIRT1015778	hsa-miR-2110	CLIP-seq
MIRT1015780	hsa-miR-214	CLIP-seq
MIRT2234216	hsa-miR-3150b-3p	CLIP-seq
MIRT1015786	hsa-miR-3156-3p	CLIP-seq
MIRT1015788	hsa-miR-3179	CLIP-seq
MIRT2000740	hsa-miR-3180	CLIP-seq
MIRT2000741	hsa-miR-3180-3p	CLIP-seq
MIRT2000742	hsa-miR-3196	CLIP-seq
MIRT1015790	hsa-miR-3202	CLIP-seq
MIRT1015791	hsa-miR-3619-5p	CLIP-seq
MIRT1015792	hsa-miR-3622b-5p	CLIP-seq
MIRT1015793	hsa-miR-3675-5p	CLIP-seq
MIRT1015796	hsa-miR-3910	CLIP-seq
MIRT1015797	hsa-miR-4262	CLIP-seq
MIRT1015799	hsa-miR-4438	CLIP-seq
MIRT2000744	hsa-miR-4477b	CLIP-seq
MIRT1015802	hsa-miR-4488	CLIP-seq
MIRT1015803	hsa-miR-4492	CLIP-seq
MIRT1015804	hsa-miR-4498	CLIP-seq
MIRT1015805	hsa-miR-4505	CLIP-seq
MIRT1015806	hsa-miR-4509	CLIP-seq
MIRT1015807	hsa-miR-450b-5p	CLIP-seq
MIRT1015812	hsa-miR-4696	CLIP-seq
MIRT1015813	hsa-miR-4697-5p	CLIP-seq
MIRT2234217	hsa-miR-4701-3p	CLIP-seq
MIRT1015814	hsa-miR-4704-5p	CLIP-seq
MIRT1015815	hsa-miR-4717-5p	CLIP-seq
MIRT1015818	hsa-miR-4731-5p	CLIP-seq
MIRT1015819	hsa-miR-4747-5p	CLIP-seq
MIRT1015821	hsa-miR-4763-3p	CLIP-seq
MIRT1015822	hsa-miR-4768-5p	CLIP-seq
MIRT2234218	hsa-miR-4773	CLIP-seq
MIRT2234219	hsa-miR-4784	CLIP-seq
MIRT1015824	hsa-miR-486-3p	CLIP-seq
MIRT1015825	hsa-miR-491-5p	CLIP-seq
MIRT2234220	hsa-miR-541	CLIP-seq
MIRT1015827	hsa-miR-545	CLIP-seq
MIRT1015828	hsa-miR-548an	CLIP-seq
MIRT1015830	hsa-miR-625	CLIP-seq
MIRT2000746	hsa-miR-637	CLIP-seq
MIRT1015831	hsa-miR-642b	CLIP-seq
MIRT1015832	hsa-miR-761	CLIP-seq
MIRT1015833	hsa-miR-762	CLIP-seq
MIRT1015760	hsa-miR-1207-5p	CLIP-seq
MIRT1015768	hsa-miR-1287	CLIP-seq
MIRT1015790	hsa-miR-3202	CLIP-seq
MIRT1015792	hsa-miR-3622b-5p	CLIP-seq
MIRT1015793	hsa-miR-3675-5p	CLIP-seq
MIRT1015796	hsa-miR-3910	CLIP-seq
MIRT1015808	hsa-miR-4652-3p	CLIP-seq
MIRT1015809	hsa-miR-4677-3p	CLIP-seq
MIRT1015810	hsa-miR-4679	CLIP-seq
MIRT1015821	hsa-miR-4763-3p	CLIP-seq
MIRT1015822	hsa-miR-4768-5p	CLIP-seq
MIRT1015824	hsa-miR-486-3p	CLIP-seq
MIRT2234220	hsa-miR-541	CLIP-seq
MIRT1015828	hsa-miR-548an	CLIP-seq
MIRT1015830	hsa-miR-625	CLIP-seq
MIRT1556445	hsa-miR-3125	CLIP-seq
MIRT2437400	hsa-miR-3685	CLIP-seq
MIRT2437401	hsa-miR-384	CLIP-seq
MIRT1556446	hsa-miR-3914	CLIP-seq
MIRT1556447	hsa-miR-3916	CLIP-seq
MIRT1556448	hsa-miR-3928	CLIP-seq
MIRT1556449	hsa-miR-4428	CLIP-seq
MIRT1015801	hsa-miR-4457	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT1556445	hsa-miR-3125	CLIP-seq
MIRT2437400	hsa-miR-3685	CLIP-seq
MIRT2437401	hsa-miR-384	CLIP-seq
MIRT1556446	hsa-miR-3914	CLIP-seq
MIRT1556447	hsa-miR-3916	CLIP-seq
MIRT1556448	hsa-miR-3928	CLIP-seq
MIRT1556449	hsa-miR-4428	CLIP-seq
MIRT1015801	hsa-miR-4457	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT2234213	hsa-miR-1262	CLIP-seq
MIRT2234214	hsa-miR-1292	CLIP-seq
MIRT2000738	hsa-miR-133a	CLIP-seq
MIRT2000739	hsa-miR-133b	CLIP-seq
MIRT2538250	hsa-miR-150	CLIP-seq
MIRT1015777	hsa-miR-1909	CLIP-seq
MIRT1015780	hsa-miR-214	CLIP-seq
MIRT2538251	hsa-miR-296-3p	CLIP-seq
MIRT1556445	hsa-miR-3125	CLIP-seq
MIRT2000740	hsa-miR-3180	CLIP-seq
MIRT2000741	hsa-miR-3180-3p	CLIP-seq
MIRT2000742	hsa-miR-3196	CLIP-seq
MIRT1015790	hsa-miR-3202	CLIP-seq
MIRT1015791	hsa-miR-3619-5p	CLIP-seq
MIRT2000743	hsa-miR-3681	CLIP-seq
MIRT2437400	hsa-miR-3685	CLIP-seq
MIRT2437401	hsa-miR-384	CLIP-seq
MIRT1556446	hsa-miR-3914	CLIP-seq
MIRT1556447	hsa-miR-3916	CLIP-seq
MIRT1556448	hsa-miR-3928	CLIP-seq
MIRT1556449	hsa-miR-4428	CLIP-seq
MIRT1015799	hsa-miR-4438	CLIP-seq
MIRT1015801	hsa-miR-4457	CLIP-seq
MIRT2538252	hsa-miR-4476	CLIP-seq
MIRT2000744	hsa-miR-4477b	CLIP-seq
MIRT1015802	hsa-miR-4488	CLIP-seq
MIRT1015803	hsa-miR-4492	CLIP-seq
MIRT1015804	hsa-miR-4498	CLIP-seq
MIRT1015805	hsa-miR-4505	CLIP-seq
MIRT2000745	hsa-miR-4697-3p	CLIP-seq
MIRT1015813	hsa-miR-4697-5p	CLIP-seq
MIRT2234217	hsa-miR-4701-3p	CLIP-seq
MIRT2538253	hsa-miR-4713-5p	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015818	hsa-miR-4731-5p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT1015824	hsa-miR-486-3p	CLIP-seq
MIRT2538254	hsa-miR-532-3p	CLIP-seq
MIRT2538255	hsa-miR-583	CLIP-seq
MIRT2000746	hsa-miR-637	CLIP-seq
MIRT1015832	hsa-miR-761	CLIP-seq
MIRT1015833	hsa-miR-762	CLIP-seq
MIRT2234213	hsa-miR-1262	CLIP-seq
MIRT2234214	hsa-miR-1292	CLIP-seq
MIRT2000738	hsa-miR-133a	CLIP-seq
MIRT2000739	hsa-miR-133b	CLIP-seq
MIRT2538250	hsa-miR-150	CLIP-seq
MIRT1015777	hsa-miR-1909	CLIP-seq
MIRT1015780	hsa-miR-214	CLIP-seq
MIRT2538251	hsa-miR-296-3p	CLIP-seq
MIRT1556445	hsa-miR-3125	CLIP-seq
MIRT2000740	hsa-miR-3180	CLIP-seq
MIRT2000741	hsa-miR-3180-3p	CLIP-seq
MIRT2000742	hsa-miR-3196	CLIP-seq
MIRT1015790	hsa-miR-3202	CLIP-seq
MIRT1015791	hsa-miR-3619-5p	CLIP-seq
MIRT2000743	hsa-miR-3681	CLIP-seq
MIRT2437400	hsa-miR-3685	CLIP-seq
MIRT2437401	hsa-miR-384	CLIP-seq
MIRT1556446	hsa-miR-3914	CLIP-seq
MIRT1556447	hsa-miR-3916	CLIP-seq
MIRT1556448	hsa-miR-3928	CLIP-seq
MIRT1556449	hsa-miR-4428	CLIP-seq
MIRT1015799	hsa-miR-4438	CLIP-seq
MIRT1015801	hsa-miR-4457	CLIP-seq
MIRT2538252	hsa-miR-4476	CLIP-seq
MIRT2000744	hsa-miR-4477b	CLIP-seq
MIRT1015802	hsa-miR-4488	CLIP-seq
MIRT1015803	hsa-miR-4492	CLIP-seq
MIRT1015804	hsa-miR-4498	CLIP-seq
MIRT1015805	hsa-miR-4505	CLIP-seq
MIRT2000745	hsa-miR-4697-3p	CLIP-seq
MIRT1015813	hsa-miR-4697-5p	CLIP-seq
MIRT2234217	hsa-miR-4701-3p	CLIP-seq
MIRT2538253	hsa-miR-4713-5p	CLIP-seq
MIRT1015817	hsa-miR-4731-3p	CLIP-seq
MIRT1015818	hsa-miR-4731-5p	CLIP-seq
MIRT1015823	hsa-miR-4801	CLIP-seq
MIRT1015824	hsa-miR-486-3p	CLIP-seq
MIRT2538254	hsa-miR-532-3p	CLIP-seq
MIRT2538255	hsa-miR-583	CLIP-seq
MIRT2000746	hsa-miR-637	CLIP-seq
MIRT1015832	hsa-miR-761	CLIP-seq
MIRT1015833	hsa-miR-762	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	35343654
GO:0005092	Function	GDP-dissociation inhibitor activity	IEA
GO:0005092	Function	GDP-dissociation inhibitor activity	TAS	7849400
GO:0005093	Function	Rab GDP-dissociation inhibitor activity	IBA
GO:0005093	Function	Rab GDP-dissociation inhibitor activity	IEA
GO:0005093	Function	Rab GDP-dissociation inhibitor activity	ISS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	11809807, 19570034, 19942850, 25416956, 25910212, 26496610, 28514442, 33961781, 35271311, 35914814
GO:0005737	Component	Cytoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	35343654
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	17684057
GO:0006893	Process	Golgi to plasma membrane transport	IDA	35343654
GO:0007165	Process	Signal transduction	TAS	7543319
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0030424	Component	Axon	IEA
GO:0030496	Component	Midbody	IDA	15166316
GO:0031267	Function	Small GTPase binding	IEA
GO:0032482	Process	Rab protein signal transduction	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0034123	Process	Positive regulation of toll-like receptor signaling pathway	IDA	35343654
GO:0034142	Process	Toll-like receptor 4 signaling pathway	IDA	10196138
GO:0043025	Component	Neuronal cell body	IEA
GO:0043209	Component	Myelin sheath	IEA
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0050771	Process	Negative regulation of axonogenesis	IEA
GO:0050771	Process	Negative regulation of axonogenesis	ISS
GO:0051592	Process	Response to calcium ion	IEA
GO:0090315	Process	Negative regulation of protein targeting to membrane	IMP	23815289
GO:0099523	Component	Presynaptic cytosol	IEA
GO:1903828	Process	Negative regulation of protein localization	IEA

MIM	HGNC	e!Ensembl
300104	4226	ENSG00000203879

P31150

Protein name

Rab GDP dissociation inhibitor alpha (Rab GDI alpha) (Guanosine diphosphate dissociation inhibitor 1) (GDI-1) (Oligophrenin-2) (Protein XAP-4)

Protein function

Regulates the GDP/GTP exchange reaction of most Rab proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Promotes the dissociation of GDP-bound Rab proteins from the membrane and inhibits their act

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00996	GDI	1 → 436	GDP dissociation inhibitor	Family

Tissue specificity

TISSUE SPECIFICITY: Brain; predominant in neural and sensory tissues. {ECO:0000269|PubMed:7543319}.

Sequence

MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLE
GPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVP
STETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQD
VIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRI
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETT
DPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI
YKRMAGTAFDFENMKRKQNDVFGEAEQ

Sequence length

447

Interactions

View interactions

	Reactome
			Rho GTPase cycle RAB GEFs exchange GTP for GDP on RABs

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Intellectual disability	Pathogenic	rs2068757385	RCV001255375	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability, X-linked 41	Likely pathogenic; Pathogenic	rs2148226455, rs2148228335, rs2523030418, rs121434608, rs121434609, rs2523033056, rs398122814, rs2068755805, rs2068750338, rs2068757385	RCV001808300 RCV002238601 RCV002283628 RCV000012393 RCV000012394 View all (5 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ovarian serous cystadenocarcinoma	Likely pathogenic	rs2148226455	RCV005922638	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (19)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GDI1-related disorder	Benign; Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunodeficiency 47	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED 41	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DEVELOPMENTAL DISORDER, X-LINKED 95	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION, X-LINKED NONSYNDROMIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SYNDROMIC X-LINKED INTELLECTUAL DISABILITY	—	ClinGen, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
X-LINKED INTELLECTUAL DISABILITY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
X-LINKED NON-SYNDROMIC INTELLECTUAL DISABILITY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (41)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
2-3 toe syndactyly	Syndactyly Of The Toes	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	8826463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19072283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24768552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	24768552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choroideremia	Choroideremia	BEFREE	11796263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	20004760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34515625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	24768552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	11796263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	20004760, 28057534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	11017088, 22002931, 28057534, 28863211, 9222958, 9620768		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	20004760, 8826463	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Macrocephaly	Macrocephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel Diverticulum	Meckel Diverticulum	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	9222958, 9620768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	11796263, 9106537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	CTD_human_DG	8826463, 9668174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked 1	Mental Retardation, X-Linked	ORPHANET_DG	22002931		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 41	Mental retardation	UNIPROT_DG	9620768, 9668174		★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 41	Mental retardation	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 41	Mental retardation	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED 41	Mental retardation	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked Nonsyndromic	Mental retardation	CLINGEN_DG	20159109, 22002931, 22291894, 9106537, 9620768, 9668174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mild neurosensory hearing impairment	Neurosensory Hearing impairment	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	24768552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16596196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	9674910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
X-linked non-syndromic intellectual disability	Non-Syndromic Intellectual Disability, X-Linked	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

GDI1 (GDP dissociation inhibitor 1)