Gene Gene information from NCBI Gene database.
Entrez ID 26578
Gene name Osteoclast stimulating factor 1
Gene symbol OSTF1
Synonyms (NCBI Gene)
OSFSH3P2bA235O14.1
Chromosome 9
Chromosome location 9q21.13
Summary Osteoclast-stimulating factor-1 is an intracellular protein produced by osteoclasts that indirectly induces osteoclast formation and bone resorption (Reddy et al., 1998 [PubMed 10092216]).[supplied by OMIM, Mar 2008]
miRNA miRNA information provided by mirtarbase database.
265
miRTarBase ID miRNA Experiments Reference
MIRT006863 hsa-miR-429 Luciferase reporter assay 22940129
MIRT023985 hsa-miR-1-3p Proteomics 18668040
MIRT029977 hsa-miR-26b-5p Microarray 19088304
MIRT667097 hsa-miR-125a-3p HITS-CLIP 23824327
MIRT667096 hsa-miR-764 HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
10
GO ID Ontology Definition Evidence Reference
GO:0001503 Process Ossification TAS 10092216
GO:0005515 Function Protein binding IPI 17500595, 23275563, 25416956, 25825872, 28514442, 33961781
GO:0005576 Component Extracellular region HDA 27068509
GO:0005576 Component Extracellular region TAS
GO:0005737 Component Cytoplasm IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
610180 8510 ENSG00000134996
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92882
Protein name Osteoclast-stimulating factor 1
Protein function Induces bone resorption, acting probably through a signaling cascade which results in the secretion of factor(s) enhancing osteoclast formation and activity.
PDB 1X2K , 1ZLM , 3EHQ , 3EHR
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00018 SH3_1 18 63 SH3 domain Domain
PF12796 Ank_2 60 137 Ankyrin repeats (3 copies) Repeat
PF12796 Ank_2 77 170 Ankyrin repeats (3 copies) Repeat
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed. Present in osteoclasts (at protein level). {ECO:0000269|PubMed:10092216}.
Sequence
MSKPPPKPVKPGQVKVFRALYTFEPRTPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGL
IPS
NYVAEQAESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKD
IVEMLFTQPNIELNQQN
KLGDTALHAAAWKGYADIVQLLLAKGARTDLRN
IEKKLAFDMA
TNAACASLLKKKQGTDAVRTLSNAEDYLDDEDSD
Sequence length 214
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ASTHMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCOLIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cholesteatoma Cholesteatoma BEFREE 15370560
★☆☆☆☆
Found in Text Mining only
Multiple Sclerosis Multiple Sclerosis BEFREE 31128979
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 27807832
★☆☆☆☆
Found in Text Mining only
Osteoporosis Osteoporosis Pubtator 30569177 Associate
★☆☆☆☆
Found in Text Mining only