Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26575
Gene name	Regulator of G protein signaling 17
Gene symbol	RGS17
Synonyms (NCBI Gene)	RGS-17RGSZ2hRGS17
Chromosome	6
Chromosome location	6q25.2
Summary	This gene encodes a member of the regulator of G-protein signaling family. This protein contains a conserved, 120 amino acid motif called the RGS domain and a cysteine-rich region. The protein attenuates the signaling activity of G-proteins by binding to

185

Show/Hide all (185)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024057	hsa-miR-1-3p	Microarray	18668037
MIRT028374	hsa-miR-32-5p	Sequencing	20371350
MIRT671793	hsa-miR-562	HITS-CLIP	23824327
MIRT671792	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT671791	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT671790	hsa-miR-5697	HITS-CLIP	23824327
MIRT671789	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT671787	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT671788	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT671786	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT671785	hsa-miR-1976	HITS-CLIP	23824327
MIRT671784	hsa-miR-1297	HITS-CLIP	23824327
MIRT671783	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT671782	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT671781	hsa-miR-4465	HITS-CLIP	23824327
MIRT671780	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT671779	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT671778	hsa-miR-4279	HITS-CLIP	23824327
MIRT540236	hsa-miR-498	HITS-CLIP	23824327
MIRT654270	hsa-miR-10a-3p	HITS-CLIP	23824327
MIRT654269	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT654268	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT654267	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT654265	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT654266	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT654264	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT540253	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540252	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540251	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540250	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540249	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540248	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540247	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540246	hsa-miR-6821-3p	PAR-CLIP	21572407
MIRT540245	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT540244	hsa-miR-6791-3p	PAR-CLIP	21572407
MIRT540243	hsa-miR-6829-3p	PAR-CLIP	21572407
MIRT540242	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540241	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540240	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540239	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540238	hsa-miR-5001-3p	PAR-CLIP	21572407
MIRT540237	hsa-miR-6836-3p	PAR-CLIP	21572407
MIRT540236	hsa-miR-498	PAR-CLIP	21572407
MIRT540253	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540252	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540251	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540250	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540249	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540248	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540247	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540246	hsa-miR-6821-3p	PAR-CLIP	21572407
MIRT540245	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT540244	hsa-miR-6791-3p	PAR-CLIP	21572407
MIRT540243	hsa-miR-6829-3p	PAR-CLIP	21572407
MIRT540242	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540241	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540240	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540239	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540238	hsa-miR-5001-3p	PAR-CLIP	21572407
MIRT540237	hsa-miR-6836-3p	PAR-CLIP	21572407
MIRT540236	hsa-miR-498	PAR-CLIP	21572407
MIRT497496	hsa-miR-1264	PAR-CLIP	22291592
MIRT497495	hsa-miR-5007-5p	PAR-CLIP	22291592
MIRT497494	hsa-miR-3973	PAR-CLIP	22291592
MIRT497493	hsa-miR-520g-3p	PAR-CLIP	22291592
MIRT497492	hsa-miR-520h	PAR-CLIP	22291592
MIRT497491	hsa-miR-936	PAR-CLIP	22291592
MIRT497490	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT497489	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT497488	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT497487	hsa-miR-4635	PAR-CLIP	22291592
MIRT497486	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT448550	hsa-miR-551b-5p	PAR-CLIP	22100165
MIRT448548	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT448549	hsa-miR-4524a-3p	PAR-CLIP	22100165
MIRT448547	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448550	hsa-miR-551b-5p	PAR-CLIP	22100165
MIRT448548	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT448549	hsa-miR-4524a-3p	PAR-CLIP	22100165
MIRT448547	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT028374	hsa-miR-32-5p	Western blot	26185539
MIRT736970	hsa-miR-149-5p	Luciferase reporter assayWestern blottingqRT-PCR	33790651
MIRT671793	hsa-miR-562	HITS-CLIP	23824327
MIRT671792	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT671791	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT671790	hsa-miR-5697	HITS-CLIP	23824327
MIRT671789	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT671787	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT671788	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT671786	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT671785	hsa-miR-1976	HITS-CLIP	23824327
MIRT671784	hsa-miR-1297	HITS-CLIP	23824327
MIRT671783	hsa-miR-26a-5p	HITS-CLIP	23824327
MIRT671782	hsa-miR-26b-5p	HITS-CLIP	23824327
MIRT671781	hsa-miR-4465	HITS-CLIP	23824327
MIRT671780	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT671779	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT671778	hsa-miR-4279	HITS-CLIP	23824327
MIRT540236	hsa-miR-498	HITS-CLIP	23824327
MIRT654270	hsa-miR-10a-3p	HITS-CLIP	23824327
MIRT654269	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT654268	hsa-miR-942-5p	HITS-CLIP	23824327
MIRT654267	hsa-miR-508-3p	HITS-CLIP	23824327
MIRT654265	hsa-miR-6868-3p	HITS-CLIP	23824327
MIRT654266	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT654264	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT540253	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540252	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540251	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540250	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540249	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540248	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540247	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540246	hsa-miR-6821-3p	PAR-CLIP	21572407
MIRT540245	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT540244	hsa-miR-6791-3p	PAR-CLIP	21572407
MIRT540243	hsa-miR-6829-3p	PAR-CLIP	21572407
MIRT540242	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540241	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540240	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540239	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540238	hsa-miR-5001-3p	PAR-CLIP	21572407
MIRT540237	hsa-miR-6836-3p	PAR-CLIP	21572407
MIRT540236	hsa-miR-498	PAR-CLIP	21572407
MIRT540253	hsa-miR-6890-3p	PAR-CLIP	21572407
MIRT540252	hsa-miR-6736-3p	PAR-CLIP	21572407
MIRT540251	hsa-miR-660-3p	PAR-CLIP	21572407
MIRT540250	hsa-miR-939-3p	PAR-CLIP	21572407
MIRT540249	hsa-miR-6852-5p	PAR-CLIP	21572407
MIRT540248	hsa-miR-6742-3p	PAR-CLIP	21572407
MIRT540247	hsa-miR-1304-3p	PAR-CLIP	21572407
MIRT540246	hsa-miR-6821-3p	PAR-CLIP	21572407
MIRT540245	hsa-miR-6778-3p	PAR-CLIP	21572407
MIRT540244	hsa-miR-6791-3p	PAR-CLIP	21572407
MIRT540243	hsa-miR-6829-3p	PAR-CLIP	21572407
MIRT540242	hsa-miR-23a-5p	PAR-CLIP	21572407
MIRT540241	hsa-miR-23b-5p	PAR-CLIP	21572407
MIRT540240	hsa-miR-1343-3p	PAR-CLIP	21572407
MIRT540239	hsa-miR-6783-3p	PAR-CLIP	21572407
MIRT540238	hsa-miR-5001-3p	PAR-CLIP	21572407
MIRT540237	hsa-miR-6836-3p	PAR-CLIP	21572407
MIRT540236	hsa-miR-498	PAR-CLIP	21572407
MIRT497496	hsa-miR-1264	PAR-CLIP	22291592
MIRT497495	hsa-miR-5007-5p	PAR-CLIP	22291592
MIRT497494	hsa-miR-3973	PAR-CLIP	22291592
MIRT497493	hsa-miR-520g-3p	PAR-CLIP	22291592
MIRT497492	hsa-miR-520h	PAR-CLIP	22291592
MIRT497491	hsa-miR-936	PAR-CLIP	22291592
MIRT497490	hsa-miR-199a-3p	PAR-CLIP	22291592
MIRT497489	hsa-miR-199b-3p	PAR-CLIP	22291592
MIRT497488	hsa-miR-3129-5p	PAR-CLIP	22291592
MIRT497487	hsa-miR-4635	PAR-CLIP	22291592
MIRT497486	hsa-miR-222-5p	PAR-CLIP	22291592
MIRT448550	hsa-miR-551b-5p	PAR-CLIP	22100165
MIRT448548	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT448549	hsa-miR-4524a-3p	PAR-CLIP	22100165
MIRT448547	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448550	hsa-miR-551b-5p	PAR-CLIP	22100165
MIRT448548	hsa-miR-410-3p	PAR-CLIP	22100165
MIRT448549	hsa-miR-4524a-3p	PAR-CLIP	22100165
MIRT448547	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT1304248	hsa-miR-128	CLIP-seq
MIRT1304249	hsa-miR-27a	CLIP-seq
MIRT1304250	hsa-miR-27b	CLIP-seq
MIRT1304251	hsa-miR-3915	CLIP-seq
MIRT1304252	hsa-miR-3928	CLIP-seq
MIRT1304253	hsa-miR-409-3p	CLIP-seq
MIRT1304254	hsa-miR-4293	CLIP-seq
MIRT1304255	hsa-miR-4694-3p	CLIP-seq
MIRT1304256	hsa-miR-5096	CLIP-seq
MIRT1304257	hsa-miR-513a-5p	CLIP-seq
MIRT1304258	hsa-miR-544b	CLIP-seq
MIRT1304259	hsa-miR-596	CLIP-seq
MIRT1304260	hsa-miR-653	CLIP-seq
MIRT2090176	hsa-miR-1271	CLIP-seq
MIRT2090177	hsa-miR-1290	CLIP-seq
MIRT2090178	hsa-miR-182	CLIP-seq
MIRT2090179	hsa-miR-4760-3p	CLIP-seq
MIRT2090180	hsa-miR-495	CLIP-seq
MIRT2090181	hsa-miR-664	CLIP-seq
MIRT2090182	hsa-miR-96	CLIP-seq
MIRT2314899	hsa-miR-3646	CLIP-seq
MIRT2314900	hsa-miR-515-5p	CLIP-seq
MIRT2393689	hsa-miR-4328	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0045202	Component	Synapse	IEA

MIM	HGNC	e!Ensembl
607191	14088	ENSG00000091844

Q9UGC6

Protein name

Regulator of G-protein signaling 17 (RGS17)

Protein function

Regulates G protein-coupled receptor signaling cascades, including signaling via muscarinic acetylcholine receptor CHRM2 and dopamine receptor DRD2. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, ther

PDB

1ZV4 , 6AM3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	84 → 199	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Predominantly expressed in the cerebellum. Also expressed in the cortex and medulla. Weakly expressed in a number of peripheral tissues notably spleen, lung and leukocytes. {ECO:0000269|PubMed:15096504}.

Sequence

MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGENAGRPTHTTK
MESIQVLEECQNPTAEEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES

Sequence length

210

Interactions

View interactions

	Reactome
			G alpha (q) signalling events G alpha (i) signalling events G alpha (z) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BELL'S PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (25)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20420807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15326299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15326299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21680864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26059414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19351763, 20142248, 20420807, 31081094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28337960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26606528, 33290408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29559347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	19351763, 20420807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20142248, 23228068, 31081094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15326299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19351763, 20142248, 20420807, 23734683, 31081094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	23535732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23734683, 28621943, 29351497, 31298318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29559347, 31298318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	30464507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28337960, 30464507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28921827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21044322, 23734683, 33845140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	23535732, 29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28621943, 29351497, 31298318		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	19244110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21680864, 23734683, 29351497, 29789573, 31298318, 33290408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38600165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS17 (regulator of G protein signaling 17)