AATF (apoptosis antagonizing transcription factor)

Gene

• Entrez ID: 26574
• Gene name: Apoptosis antagonizing transcription factor
• Gene symbol: AATF
• Synonyms (NCBI Gene): BFR2, CHE-1, CHE1, DED
• Chromosome: 17
• Chromosome location: 17q12
• Summary: The protein encoded by this gene was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of tra

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022994	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT052353	hsa-let-7b-5p	CLASH	23622248
MIRT045596	hsa-miR-149-5p	CLASH	23622248
MIRT043604	hsa-miR-151a-3p	CLASH	23622248
MIRT495366	hsa-miR-524-3p	PAR-CLIP	23708386
MIRT495365	hsa-miR-525-3p	PAR-CLIP	23708386
MIRT495364	hsa-miR-634	PAR-CLIP	23708386
MIRT495363	hsa-miR-1226-3p	PAR-CLIP	23708386
MIRT495361	hsa-miR-4530	PAR-CLIP	23708386
MIRT495366	hsa-miR-524-3p	PAR-CLIP	23708386
MIRT495365	hsa-miR-525-3p	PAR-CLIP	23708386
MIRT495364	hsa-miR-634	PAR-CLIP	23708386
MIRT495363	hsa-miR-1226-3p	PAR-CLIP	23708386
MIRT495361	hsa-miR-4530	PAR-CLIP	23708386
MIRT757624	hsa-miR-142-5p	CLIP-seq
MIRT757625	hsa-miR-224	CLIP-seq
MIRT757626	hsa-miR-3189-5p	CLIP-seq
MIRT757627	hsa-miR-4323	CLIP-seq
MIRT757628	hsa-miR-4474-3p	CLIP-seq
MIRT757629	hsa-miR-4661-5p	CLIP-seq
MIRT757630	hsa-miR-4690-3p	CLIP-seq
MIRT1923427	hsa-miR-3619-3p	CLIP-seq
MIRT1923428	hsa-miR-378	CLIP-seq
MIRT1923429	hsa-miR-378b	CLIP-seq
MIRT1923430	hsa-miR-378c	CLIP-seq
MIRT1923431	hsa-miR-378d	CLIP-seq
MIRT1923432	hsa-miR-378e	CLIP-seq
MIRT1923433	hsa-miR-378f	CLIP-seq
MIRT1923434	hsa-miR-378h	CLIP-seq
MIRT1923435	hsa-miR-378i	CLIP-seq
MIRT1923436	hsa-miR-422a	CLIP-seq
MIRT1923437	hsa-miR-4638-3p	CLIP-seq
MIRT1923438	hsa-miR-4691-5p	CLIP-seq
MIRT1923439	hsa-miR-4776-5p	CLIP-seq
MIRT2164912	hsa-miR-1238	CLIP-seq
MIRT2164913	hsa-miR-2277-3p	CLIP-seq
MIRT1923427	hsa-miR-3619-3p	CLIP-seq
MIRT2164914	hsa-miR-3622a-5p	CLIP-seq
MIRT1923428	hsa-miR-378	CLIP-seq
MIRT1923429	hsa-miR-378b	CLIP-seq
MIRT1923430	hsa-miR-378c	CLIP-seq
MIRT1923431	hsa-miR-378d	CLIP-seq
MIRT1923432	hsa-miR-378e	CLIP-seq
MIRT1923433	hsa-miR-378f	CLIP-seq
MIRT1923434	hsa-miR-378h	CLIP-seq
MIRT1923435	hsa-miR-378i	CLIP-seq
MIRT1923436	hsa-miR-422a	CLIP-seq
MIRT2164915	hsa-miR-4423-3p	CLIP-seq
MIRT1923437	hsa-miR-4638-3p	CLIP-seq
MIRT1923438	hsa-miR-4691-5p	CLIP-seq
MIRT1923439	hsa-miR-4776-5p	CLIP-seq
MIRT2383732	hsa-miR-103a	CLIP-seq
MIRT2383733	hsa-miR-107	CLIP-seq
MIRT2164914	hsa-miR-3622a-5p	CLIP-seq
MIRT2164915	hsa-miR-4423-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	10783144, 12847090, 17157788, 22909821, 25416956, 29232376, 30021884, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	10580117, 12429849, 14627703, 15207272
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	14627703, 15207272
GO:0005737	Component	Cytoplasm	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IEA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0040016	Process	Embryonic cleavage	IEA
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797
GO:0042985	Process	Negative regulation of amyloid precursor protein biosynthetic process	IEA
GO:0043522	Function	Leucine zipper domain binding	IPI	10580117, 14627703
GO:2001234	Process	Negative regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 608463
• HGNC: 19235
• e!Ensembl: ENSG00000275700

Protein

• UniProt ID: Q9NY61
• Protein name: Protein AATF (Apoptosis-antagonizing transcription factor) (Rb-binding protein Che-1)
• Protein function: Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associat
• PDB: 5W6A, 7MQ8, 7MQ9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13339	AATF-Che1	220 → 373	Apoptosis antagonizing transcription factor	Family
  PF08164	TRAUB	464 → 548	Apoptosis-antagonizing transcription factor, C-terminal	Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed. Expressed at high levels in brain, heart, kidney, placenta and thymus. {ECO:0000269|PubMed:10783144, ECO:0000269|PubMed:11027528}.
• Sequence:

  MAGPQPLALQLEQLLNPRPSEADPEADPEEATAARVIDRFDEGEDGEGDFLVVGSIRKLA
  SASLLDTDKRYCGKTTSRKAWNEDHWEQTLPGSSDEEISDEEGSGDEDSEGLGLEEYDED
  DLGAAEEQECGDHRESKKSRSHSAKTPGFSVQSISDFEKFTKGMDDLGSSEEEEDEESGM
  EEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEG
  RIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLRSLVGLQEELLFQY
  PDTRYLVDGTKPNAGSEEISSEDDELVEEKKQQRRRVPAKRKLEMEDYPSFMAKRFADFT
  VYRNRTLQKWHDKTKLASGKLGKGFGAFERSILTQIDHILMDKERLLRRTQTKRSVYRVL
  GKPEPAAQPVPESLPGEPEILPQAPANAHLKDLDEEIFDDDDFYHQLLRELIERKTSSLD
  PNDQVAMGRQWLAIQKLRSKIHKKVDRKASKGRKLRFHVLSKLLSFMAPIDHTTMNDDAR
  TELYRSLFGQLHPPDEGHGD

• Sequence length: 560

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31379487		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	30767763		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	20025740		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20025740, 27012205		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	27639846	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12847090		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32382568	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29321668		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22120020		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12847090		★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	28646862		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	36291689	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22909821		★☆☆☆☆ Found in Text Mining only
Esophageal Atresia	Esophageal Atresia	BEFREE	24239950		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32019955	Associate	★☆☆☆☆ Found in Text Mining only
Hyperpituitarism	Hyperpituitarism	Pubtator	25867808	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	29526828		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30394550		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20025740, 27012205		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29321668		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20025740, 25231211, 27012205, 28622443, 29232376, 29321668		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27012205		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33186461, 35929179	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29509260		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20708154, 22909821, 30338213		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30338213		★☆☆☆☆ Found in Text Mining only
Nephronophthisis	Nephronophthisis	BEFREE	30770218		★☆☆☆☆ Found in Text Mining only
Nephronophthisis 3	Nephronophthisis	Pubtator	39408701	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22909821, 31545418		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30394550		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27012205		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	24239950		★☆☆☆☆ Found in Text Mining only
VACTERL Association	VACTERL Association	BEFREE	24239950		★☆☆☆☆ Found in Text Mining only
VATER Association	VACTERL ASSOCIATION	BEFREE	24239950		★☆☆☆☆ Found in Text Mining only