Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	26524
Gene name	Large tumor suppressor kinase 2
Gene symbol	LATS2
Synonyms (NCBI Gene)	KPM
Chromosome	13
Chromosome location	13q12.11
Summary	This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is r

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1565941245	->G	Likely-pathogenic	Frameshift variant, coding sequence variant, intron variant

463

Show/Hide all (463)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	19501585
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	19501585
MIRT002446	hsa-miR-372-3p	ReviewLuciferase reporter assayWestern blot	20216554
MIRT001754	hsa-miR-373-3p	ReviewLuciferase reporter assayWestern blot	20216554
MIRT000491	hsa-miR-31-5p	qRT-PCRLuciferase reporter assay	20237410
MIRT001754	hsa-miR-373-3p	Luciferase reporter assay	19501585
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	16564011
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	16564011
MIRT002446	hsa-miR-372-3p	Luciferase reporter assay	18155131
MIRT002446	hsa-miR-372-3p	Luciferase reporter assay	18155131
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayWestern blot	22027184
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayWestern blot	22027184
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	22027184
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	22027184
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayWestern blot	22027184
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayWestern blot	22027184
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	22027184
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	22027184
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayWestern blot	22027184
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayWestern blot	22027184
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	22027184
MIRT001754	hsa-miR-373-3p	Luciferase reporter assayWestern blot	22027184
MIRT007185	hsa-miR-93-5p	Luciferase reporter assayqRT-PCRWestern blot	23111389
MIRT001754	hsa-miR-373-3p	Reporter assay	16564011
MIRT002446	hsa-miR-372-3p	Reporter assay	16564011
MIRT052904	hsa-miR-181b-5p	Luciferase reporter assayqRT-PCRWestern blot	24735543
MIRT052904	hsa-miR-181b-5p	Luciferase reporter assayqRT-PCRWestern blot	24735543
MIRT002446	hsa-miR-372-3p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	19937137
MIRT054147	hsa-miR-135b-3p	MicroarrayqRT-PCR	22660396
MIRT054311	hsa-miR-107	Luciferase reporter assayqRT-PCRWestern blot	25824045
MIRT054311	hsa-miR-107	Luciferase reporter assayqRT-PCRWestern blot	25824045
MIRT054312	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	25824045
MIRT054312	hsa-miR-25-3p	Luciferase reporter assayqRT-PCRWestern blot	25824045
MIRT708077	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT708076	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT708075	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT708074	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT474272	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT474271	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT474270	hsa-miR-3153	PAR-CLIP	23592263
MIRT474269	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT474268	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT474267	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT474266	hsa-miR-548m	PAR-CLIP	23592263
MIRT474265	hsa-miR-548ag	PAR-CLIP	23592263
MIRT474264	hsa-miR-548ai	PAR-CLIP	23592263
MIRT474263	hsa-miR-548ba	PAR-CLIP	23592263
MIRT474262	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT474261	hsa-miR-562	PAR-CLIP	23592263
MIRT474260	hsa-miR-1178-5p	PAR-CLIP	23592263
MIRT474259	hsa-miR-1182	PAR-CLIP	23592263
MIRT474258	hsa-miR-183-5p	PAR-CLIP	23592263
MIRT474257	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT474256	hsa-miR-4257	PAR-CLIP	23592263
MIRT474255	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT474254	hsa-miR-6773-3p	PAR-CLIP	23592263
MIRT474253	hsa-miR-215-3p	PAR-CLIP	23592263
MIRT474252	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT474251	hsa-miR-1256	PAR-CLIP	23592263
MIRT474249	hsa-miR-6801-5p	PAR-CLIP	23592263
MIRT474250	hsa-miR-4697-3p	PAR-CLIP	23592263
MIRT474248	hsa-miR-223-3p	PAR-CLIP	23592263
MIRT054147	hsa-miR-135b-3p	Luciferase reporter assayqRT-PCRWestern blot	26934863
MIRT054147	hsa-miR-135b-3p	ImmunofluorescenceWestern blot	26101704
MIRT054147	hsa-miR-135b-3p	ImmunofluorescenceWestern blot	26101704
MIRT474260	hsa-miR-1178-5p	PAR-CLIP	26701625
MIRT474259	hsa-miR-1182	PAR-CLIP	26701625
MIRT474251	hsa-miR-1256	PAR-CLIP	26701625
MIRT474258	hsa-miR-183-5p	PAR-CLIP	26701625
MIRT474252	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT474253	hsa-miR-215-3p	PAR-CLIP	26701625
MIRT474248	hsa-miR-223-3p	PAR-CLIP	26701625
MIRT474256	hsa-miR-4257	PAR-CLIP	26701625
MIRT474250	hsa-miR-4697-3p	PAR-CLIP	26701625
MIRT474255	hsa-miR-545-5p	PAR-CLIP	26701625
MIRT474265	hsa-miR-548ag	PAR-CLIP	26701625
MIRT474264	hsa-miR-548ai	PAR-CLIP	26701625
MIRT474263	hsa-miR-548ba	PAR-CLIP	26701625
MIRT474266	hsa-miR-548m	PAR-CLIP	26701625
MIRT474261	hsa-miR-562	PAR-CLIP	26701625
MIRT474262	hsa-miR-570-5p	PAR-CLIP	26701625
MIRT474254	hsa-miR-6773-3p	PAR-CLIP	26701625
MIRT474249	hsa-miR-6801-5p	PAR-CLIP	26701625
MIRT474257	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT474260	hsa-miR-1178-5p	PAR-CLIP	27292025
MIRT474259	hsa-miR-1182	PAR-CLIP	27292025
MIRT474251	hsa-miR-1256	PAR-CLIP	27292025
MIRT474258	hsa-miR-183-5p	PAR-CLIP	27292025
MIRT474252	hsa-miR-202-3p	PAR-CLIP	27292025
MIRT474253	hsa-miR-215-3p	PAR-CLIP	27292025
MIRT474248	hsa-miR-223-3p	PAR-CLIP	27292025
MIRT474256	hsa-miR-4257	PAR-CLIP	27292025
MIRT474250	hsa-miR-4697-3p	PAR-CLIP	27292025
MIRT474255	hsa-miR-545-5p	PAR-CLIP	27292025
MIRT474265	hsa-miR-548ag	PAR-CLIP	27292025
MIRT474264	hsa-miR-548ai	PAR-CLIP	27292025
MIRT474263	hsa-miR-548ba	PAR-CLIP	27292025
MIRT474266	hsa-miR-548m	PAR-CLIP	27292025
MIRT474261	hsa-miR-562	PAR-CLIP	27292025
MIRT474262	hsa-miR-570-5p	PAR-CLIP	27292025
MIRT474254	hsa-miR-6773-3p	PAR-CLIP	27292025
MIRT474249	hsa-miR-6801-5p	PAR-CLIP	27292025
MIRT474257	hsa-miR-6847-5p	PAR-CLIP	27292025
MIRT708077	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT708075	hsa-miR-4789-5p	HITS-CLIP	27418678
MIRT708074	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT708076	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT732994	hsa-miR-92a-3p	Luciferase reporter assayqRT-PCRWestern blotting	33162971
MIRT733458	hsa-miR-26b-5p	RNA-seqqRT-PCR	34209741
MIRT733461	hsa-miR-21-5p	RNA-seqqRT-PCR	34209741
MIRT028387	hsa-miR-31-5p	Immunohistochemistry (IHC)Luciferase reporter assayMicroarrayqRT-PCRWestern blotting	31623173
MIRT734088	hsa-miR-2278	Luciferase reporter assayqRT-PCRWestern blotting	33576454
MIRT708077	hsa-miR-223-5p	HITS-CLIP	21572407
MIRT708076	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT708075	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT708074	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT474272	hsa-miR-494-3p	PAR-CLIP	23592263
MIRT474271	hsa-miR-4668-5p	PAR-CLIP	23592263
MIRT474270	hsa-miR-3153	PAR-CLIP	23592263
MIRT474269	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT474268	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT474267	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT474266	hsa-miR-548m	PAR-CLIP	23592263
MIRT474265	hsa-miR-548ag	PAR-CLIP	23592263
MIRT474264	hsa-miR-548ai	PAR-CLIP	23592263
MIRT474263	hsa-miR-548ba	PAR-CLIP	23592263
MIRT474262	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT474261	hsa-miR-562	PAR-CLIP	23592263
MIRT474260	hsa-miR-1178-5p	PAR-CLIP	23592263
MIRT474259	hsa-miR-1182	PAR-CLIP	23592263
MIRT474258	hsa-miR-183-5p	PAR-CLIP	23592263
MIRT474257	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT474256	hsa-miR-4257	PAR-CLIP	23592263
MIRT474255	hsa-miR-545-5p	PAR-CLIP	23592263
MIRT474254	hsa-miR-6773-3p	PAR-CLIP	23592263
MIRT474253	hsa-miR-215-3p	PAR-CLIP	23592263
MIRT474252	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT474251	hsa-miR-1256	PAR-CLIP	23592263
MIRT474249	hsa-miR-6801-5p	PAR-CLIP	23592263
MIRT474250	hsa-miR-4697-3p	PAR-CLIP	23592263
MIRT474248	hsa-miR-223-3p	PAR-CLIP	23592263
MIRT1105152	hsa-miR-103a	CLIP-seq
MIRT1105153	hsa-miR-103b	CLIP-seq
MIRT1105154	hsa-miR-1200	CLIP-seq
MIRT1105155	hsa-miR-1227	CLIP-seq
MIRT1105156	hsa-miR-1246	CLIP-seq
MIRT1105157	hsa-miR-1257	CLIP-seq
MIRT1105158	hsa-miR-1261	CLIP-seq
MIRT1105159	hsa-miR-127-5p	CLIP-seq
MIRT1105160	hsa-miR-1276	CLIP-seq
MIRT1105161	hsa-miR-1297	CLIP-seq
MIRT1105162	hsa-miR-1305	CLIP-seq
MIRT1105163	hsa-miR-137	CLIP-seq
MIRT1105164	hsa-miR-140-3p	CLIP-seq
MIRT1105165	hsa-miR-147	CLIP-seq
MIRT1105166	hsa-miR-15a	CLIP-seq
MIRT1105167	hsa-miR-15b	CLIP-seq
MIRT1105168	hsa-miR-16	CLIP-seq
MIRT1105169	hsa-miR-181a	CLIP-seq
MIRT1105170	hsa-miR-181b	CLIP-seq
MIRT1105171	hsa-miR-181c	CLIP-seq
MIRT1105172	hsa-miR-181d	CLIP-seq
MIRT1105173	hsa-miR-183	CLIP-seq
MIRT1105174	hsa-miR-195	CLIP-seq
MIRT1105175	hsa-miR-200b	CLIP-seq
MIRT1105176	hsa-miR-200c	CLIP-seq
MIRT1105177	hsa-miR-202	CLIP-seq
MIRT1105178	hsa-miR-2116	CLIP-seq
MIRT1105179	hsa-miR-223	CLIP-seq
MIRT1105180	hsa-miR-25	CLIP-seq
MIRT1105181	hsa-miR-26a	CLIP-seq
MIRT1105182	hsa-miR-26b	CLIP-seq
MIRT1105183	hsa-miR-302a	CLIP-seq
MIRT1105184	hsa-miR-302b	CLIP-seq
MIRT1105185	hsa-miR-302c	CLIP-seq
MIRT1105186	hsa-miR-302d	CLIP-seq
MIRT1105187	hsa-miR-302e	CLIP-seq
MIRT1105188	hsa-miR-3065-3p	CLIP-seq
MIRT1105189	hsa-miR-3074-3p	CLIP-seq
MIRT1105190	hsa-miR-30a	CLIP-seq
MIRT1105191	hsa-miR-30b	CLIP-seq
MIRT1105192	hsa-miR-30c	CLIP-seq
MIRT1105193	hsa-miR-30d	CLIP-seq
MIRT1105194	hsa-miR-30e	CLIP-seq
MIRT1105195	hsa-miR-3133	CLIP-seq
MIRT1105196	hsa-miR-3163	CLIP-seq
MIRT1105197	hsa-miR-32	CLIP-seq
MIRT1105198	hsa-miR-323-3p	CLIP-seq
MIRT1105199	hsa-miR-342-3p	CLIP-seq
MIRT1105200	hsa-miR-361-5p	CLIP-seq
MIRT1105201	hsa-miR-363	CLIP-seq
MIRT1105202	hsa-miR-3660	CLIP-seq
MIRT1105203	hsa-miR-3662	CLIP-seq
MIRT1105204	hsa-miR-3668	CLIP-seq
MIRT1105205	hsa-miR-367	CLIP-seq
MIRT1105206	hsa-miR-3679-3p	CLIP-seq
MIRT1105207	hsa-miR-3685	CLIP-seq
MIRT1105208	hsa-miR-3691-5p	CLIP-seq
MIRT1105209	hsa-miR-3692	CLIP-seq
MIRT1105210	hsa-miR-372	CLIP-seq
MIRT1105211	hsa-miR-373	CLIP-seq
MIRT1105212	hsa-miR-377	CLIP-seq
MIRT1105213	hsa-miR-384	CLIP-seq
MIRT1105214	hsa-miR-3911	CLIP-seq
MIRT1105215	hsa-miR-3973	CLIP-seq
MIRT1105216	hsa-miR-424	CLIP-seq
MIRT1105217	hsa-miR-4251	CLIP-seq
MIRT1105218	hsa-miR-4252	CLIP-seq
MIRT1105219	hsa-miR-4262	CLIP-seq
MIRT1105220	hsa-miR-4265	CLIP-seq
MIRT1105221	hsa-miR-4267	CLIP-seq
MIRT1105222	hsa-miR-4269	CLIP-seq
MIRT1105223	hsa-miR-4276	CLIP-seq
MIRT1105224	hsa-miR-4277	CLIP-seq
MIRT1105225	hsa-miR-4289	CLIP-seq
MIRT1105226	hsa-miR-429	CLIP-seq
MIRT1105227	hsa-miR-4296	CLIP-seq
MIRT1105228	hsa-miR-4302	CLIP-seq
MIRT1105229	hsa-miR-4322	CLIP-seq
MIRT1105230	hsa-miR-4324	CLIP-seq
MIRT1105231	hsa-miR-4328	CLIP-seq
MIRT1105232	hsa-miR-4417	CLIP-seq
MIRT1105233	hsa-miR-4420	CLIP-seq
MIRT1105234	hsa-miR-4465	CLIP-seq
MIRT1105235	hsa-miR-4495	CLIP-seq
MIRT1105236	hsa-miR-4511	CLIP-seq
MIRT1105237	hsa-miR-4526	CLIP-seq
MIRT1105238	hsa-miR-4645-3p	CLIP-seq
MIRT1105239	hsa-miR-4663	CLIP-seq
MIRT1105240	hsa-miR-4666-3p	CLIP-seq
MIRT1105241	hsa-miR-4672	CLIP-seq
MIRT1105242	hsa-miR-4677-3p	CLIP-seq
MIRT1105243	hsa-miR-4677-5p	CLIP-seq
MIRT1105244	hsa-miR-4682	CLIP-seq
MIRT1105245	hsa-miR-4700-3p	CLIP-seq
MIRT1105246	hsa-miR-4704-3p	CLIP-seq
MIRT1105247	hsa-miR-4709-3p	CLIP-seq
MIRT1105248	hsa-miR-4712-5p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT1105250	hsa-miR-4728-3p	CLIP-seq
MIRT1105251	hsa-miR-4729	CLIP-seq
MIRT1105252	hsa-miR-4752	CLIP-seq
MIRT1105253	hsa-miR-4756-3p	CLIP-seq
MIRT1105254	hsa-miR-4759	CLIP-seq
MIRT1105255	hsa-miR-4771	CLIP-seq
MIRT1105256	hsa-miR-4773	CLIP-seq
MIRT1105257	hsa-miR-4797-3p	CLIP-seq
MIRT1105258	hsa-miR-496	CLIP-seq
MIRT1105259	hsa-miR-497	CLIP-seq
MIRT1105260	hsa-miR-498	CLIP-seq
MIRT1105261	hsa-miR-499a-5p	CLIP-seq
MIRT1105262	hsa-miR-511	CLIP-seq
MIRT1105263	hsa-miR-519a	CLIP-seq
MIRT1105264	hsa-miR-519b-3p	CLIP-seq
MIRT1105265	hsa-miR-519c-3p	CLIP-seq
MIRT1105266	hsa-miR-520a-3p	CLIP-seq
MIRT1105267	hsa-miR-520b	CLIP-seq
MIRT1105268	hsa-miR-520c-3p	CLIP-seq
MIRT1105269	hsa-miR-520d-3p	CLIP-seq
MIRT1105270	hsa-miR-520e	CLIP-seq
MIRT1105271	hsa-miR-520g	CLIP-seq
MIRT1105272	hsa-miR-520h	CLIP-seq
MIRT1105273	hsa-miR-539	CLIP-seq
MIRT1105274	hsa-miR-543	CLIP-seq
MIRT1105275	hsa-miR-544b	CLIP-seq
MIRT1105276	hsa-miR-548aa	CLIP-seq
MIRT1105277	hsa-miR-548ac	CLIP-seq
MIRT1105278	hsa-miR-548ae	CLIP-seq
MIRT1105279	hsa-miR-548aj	CLIP-seq
MIRT1105280	hsa-miR-548am	CLIP-seq
MIRT1105281	hsa-miR-548b-3p	CLIP-seq
MIRT1105282	hsa-miR-548d-3p	CLIP-seq
MIRT1105283	hsa-miR-548g	CLIP-seq
MIRT1105284	hsa-miR-548l	CLIP-seq
MIRT1105285	hsa-miR-548t	CLIP-seq
MIRT1105286	hsa-miR-548u	CLIP-seq
MIRT1105287	hsa-miR-548x	CLIP-seq
MIRT1105288	hsa-miR-548z	CLIP-seq
MIRT1105289	hsa-miR-564	CLIP-seq
MIRT1105290	hsa-miR-570	CLIP-seq
MIRT1105291	hsa-miR-578	CLIP-seq
MIRT1105292	hsa-miR-607	CLIP-seq
MIRT1105293	hsa-miR-622	CLIP-seq
MIRT1105294	hsa-miR-633	CLIP-seq
MIRT1105295	hsa-miR-634	CLIP-seq
MIRT1105296	hsa-miR-644	CLIP-seq
MIRT1105297	hsa-miR-654-3p	CLIP-seq
MIRT1105298	hsa-miR-770-5p	CLIP-seq
MIRT1105299	hsa-miR-922	CLIP-seq
MIRT1105300	hsa-miR-92a	CLIP-seq
MIRT1105301	hsa-miR-92b	CLIP-seq
MIRT1105302	hsa-miR-936	CLIP-seq
MIRT1105153	hsa-miR-103b	CLIP-seq
MIRT1105157	hsa-miR-1257	CLIP-seq
MIRT1105183	hsa-miR-302a	CLIP-seq
MIRT1105184	hsa-miR-302b	CLIP-seq
MIRT1105185	hsa-miR-302c	CLIP-seq
MIRT1105186	hsa-miR-302d	CLIP-seq
MIRT1105187	hsa-miR-302e	CLIP-seq
MIRT1105190	hsa-miR-30a	CLIP-seq
MIRT1105191	hsa-miR-30b	CLIP-seq
MIRT1105192	hsa-miR-30c	CLIP-seq
MIRT1105193	hsa-miR-30d	CLIP-seq
MIRT1105194	hsa-miR-30e	CLIP-seq
MIRT1105198	hsa-miR-323-3p	CLIP-seq
MIRT1105199	hsa-miR-342-3p	CLIP-seq
MIRT1105210	hsa-miR-372	CLIP-seq
MIRT1105211	hsa-miR-373	CLIP-seq
MIRT1105212	hsa-miR-377	CLIP-seq
MIRT1105235	hsa-miR-4495	CLIP-seq
MIRT1105241	hsa-miR-4672	CLIP-seq
MIRT1550686	hsa-miR-4680-5p	CLIP-seq
MIRT1105248	hsa-miR-4712-5p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT1105263	hsa-miR-519a	CLIP-seq
MIRT1105264	hsa-miR-519b-3p	CLIP-seq
MIRT1105265	hsa-miR-519c-3p	CLIP-seq
MIRT1105266	hsa-miR-520a-3p	CLIP-seq
MIRT1105267	hsa-miR-520b	CLIP-seq
MIRT1105268	hsa-miR-520c-3p	CLIP-seq
MIRT1105269	hsa-miR-520d-3p	CLIP-seq
MIRT1105270	hsa-miR-520e	CLIP-seq
MIRT1550687	hsa-miR-767-3p	CLIP-seq
MIRT1105298	hsa-miR-770-5p	CLIP-seq
MIRT1105154	hsa-miR-1200	CLIP-seq
MIRT1105157	hsa-miR-1257	CLIP-seq
MIRT1105158	hsa-miR-1261	CLIP-seq
MIRT1105160	hsa-miR-1276	CLIP-seq
MIRT1105173	hsa-miR-183	CLIP-seq
MIRT2029035	hsa-miR-194	CLIP-seq
MIRT1105175	hsa-miR-200b	CLIP-seq
MIRT1105176	hsa-miR-200c	CLIP-seq
MIRT1105178	hsa-miR-2116	CLIP-seq
MIRT1105189	hsa-miR-3074-3p	CLIP-seq
MIRT2029036	hsa-miR-3074-5p	CLIP-seq
MIRT1105190	hsa-miR-30a	CLIP-seq
MIRT1105191	hsa-miR-30b	CLIP-seq
MIRT1105192	hsa-miR-30c	CLIP-seq
MIRT1105193	hsa-miR-30d	CLIP-seq
MIRT1105194	hsa-miR-30e	CLIP-seq
MIRT2029037	hsa-miR-3135	CLIP-seq
MIRT2029038	hsa-miR-3148	CLIP-seq
MIRT1105196	hsa-miR-3163	CLIP-seq
MIRT1105198	hsa-miR-323-3p	CLIP-seq
MIRT1105202	hsa-miR-3660	CLIP-seq
MIRT1105206	hsa-miR-3679-3p	CLIP-seq
MIRT1105207	hsa-miR-3685	CLIP-seq
MIRT1105212	hsa-miR-377	CLIP-seq
MIRT1105213	hsa-miR-384	CLIP-seq
MIRT2029039	hsa-miR-4263	CLIP-seq
MIRT1105221	hsa-miR-4267	CLIP-seq
MIRT1105224	hsa-miR-4277	CLIP-seq
MIRT1105226	hsa-miR-429	CLIP-seq
MIRT1105231	hsa-miR-4328	CLIP-seq
MIRT2029040	hsa-miR-4423-5p	CLIP-seq
MIRT1105235	hsa-miR-4495	CLIP-seq
MIRT1105237	hsa-miR-4526	CLIP-seq
MIRT1105238	hsa-miR-4645-3p	CLIP-seq
MIRT1105241	hsa-miR-4672	CLIP-seq
MIRT1105243	hsa-miR-4677-5p	CLIP-seq
MIRT1105248	hsa-miR-4712-5p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT2029041	hsa-miR-4774-3p	CLIP-seq
MIRT1105257	hsa-miR-4797-3p	CLIP-seq
MIRT2029042	hsa-miR-495	CLIP-seq
MIRT1105262	hsa-miR-511	CLIP-seq
MIRT1105277	hsa-miR-548ac	CLIP-seq
MIRT1105281	hsa-miR-548b-3p	CLIP-seq
MIRT1105282	hsa-miR-548d-3p	CLIP-seq
MIRT1105284	hsa-miR-548l	CLIP-seq
MIRT1105288	hsa-miR-548z	CLIP-seq
MIRT1105289	hsa-miR-564	CLIP-seq
MIRT2029043	hsa-miR-595	CLIP-seq
MIRT1105297	hsa-miR-654-3p	CLIP-seq
MIRT1105298	hsa-miR-770-5p	CLIP-seq
MIRT1105153	hsa-miR-103b	CLIP-seq
MIRT1105158	hsa-miR-1261	CLIP-seq
MIRT1105196	hsa-miR-3163	CLIP-seq
MIRT1105198	hsa-miR-323-3p	CLIP-seq
MIRT2260008	hsa-miR-329	CLIP-seq
MIRT1105199	hsa-miR-342-3p	CLIP-seq
MIRT1105200	hsa-miR-361-5p	CLIP-seq
MIRT2260009	hsa-miR-362-3p	CLIP-seq
MIRT1105212	hsa-miR-377	CLIP-seq
MIRT1105218	hsa-miR-4252	CLIP-seq
MIRT1105222	hsa-miR-4269	CLIP-seq
MIRT1105240	hsa-miR-4666-3p	CLIP-seq
MIRT2260010	hsa-miR-4691-3p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT1105251	hsa-miR-4729	CLIP-seq
MIRT1105255	hsa-miR-4771	CLIP-seq
MIRT1105257	hsa-miR-4797-3p	CLIP-seq
MIRT1105258	hsa-miR-496	CLIP-seq
MIRT1105261	hsa-miR-499a-5p	CLIP-seq
MIRT1105299	hsa-miR-922	CLIP-seq
MIRT1105198	hsa-miR-323-3p	CLIP-seq
MIRT2390076	hsa-miR-3545-3p	CLIP-seq
MIRT1105200	hsa-miR-361-5p	CLIP-seq
MIRT1105202	hsa-miR-3660	CLIP-seq
MIRT1105237	hsa-miR-4526	CLIP-seq
MIRT1105238	hsa-miR-4645-3p	CLIP-seq
MIRT1105164	hsa-miR-140-3p	CLIP-seq
MIRT1105189	hsa-miR-3074-3p	CLIP-seq
MIRT1105190	hsa-miR-30a	CLIP-seq
MIRT1105191	hsa-miR-30b	CLIP-seq
MIRT1105192	hsa-miR-30c	CLIP-seq
MIRT1105193	hsa-miR-30d	CLIP-seq
MIRT1105194	hsa-miR-30e	CLIP-seq
MIRT2029037	hsa-miR-3135	CLIP-seq
MIRT2029039	hsa-miR-4263	CLIP-seq
MIRT2029040	hsa-miR-4423-5p	CLIP-seq
MIRT1105235	hsa-miR-4495	CLIP-seq
MIRT1105241	hsa-miR-4672	CLIP-seq
MIRT1105248	hsa-miR-4712-5p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT1105253	hsa-miR-4756-3p	CLIP-seq
MIRT2029041	hsa-miR-4774-3p	CLIP-seq
MIRT1105281	hsa-miR-548b-3p	CLIP-seq
MIRT1105284	hsa-miR-548l	CLIP-seq
MIRT2029043	hsa-miR-595	CLIP-seq
MIRT1105298	hsa-miR-770-5p	CLIP-seq
MIRT2029035	hsa-miR-194	CLIP-seq
MIRT1105190	hsa-miR-30a	CLIP-seq
MIRT1105191	hsa-miR-30b	CLIP-seq
MIRT1105192	hsa-miR-30c	CLIP-seq
MIRT1105193	hsa-miR-30d	CLIP-seq
MIRT1105194	hsa-miR-30e	CLIP-seq
MIRT2438326	hsa-miR-31	CLIP-seq
MIRT2438327	hsa-miR-369-3p	CLIP-seq
MIRT2438328	hsa-miR-374a	CLIP-seq
MIRT2438329	hsa-miR-374b	CLIP-seq
MIRT1105212	hsa-miR-377	CLIP-seq
MIRT1105235	hsa-miR-4495	CLIP-seq
MIRT1105236	hsa-miR-4511	CLIP-seq
MIRT1105238	hsa-miR-4645-3p	CLIP-seq
MIRT1105241	hsa-miR-4672	CLIP-seq
MIRT1105245	hsa-miR-4700-3p	CLIP-seq
MIRT1105248	hsa-miR-4712-5p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT1105254	hsa-miR-4759	CLIP-seq
MIRT2438330	hsa-miR-4775	CLIP-seq
MIRT1105281	hsa-miR-548b-3p	CLIP-seq
MIRT1105290	hsa-miR-570	CLIP-seq
MIRT2438331	hsa-miR-590-3p	CLIP-seq
MIRT1105298	hsa-miR-770-5p	CLIP-seq
MIRT1105190	hsa-miR-30a	CLIP-seq
MIRT1105191	hsa-miR-30b	CLIP-seq
MIRT1105192	hsa-miR-30c	CLIP-seq
MIRT1105193	hsa-miR-30d	CLIP-seq
MIRT1105194	hsa-miR-30e	CLIP-seq
MIRT1105212	hsa-miR-377	CLIP-seq
MIRT1105235	hsa-miR-4495	CLIP-seq
MIRT1105241	hsa-miR-4672	CLIP-seq
MIRT1105248	hsa-miR-4712-5p	CLIP-seq
MIRT1105249	hsa-miR-4719	CLIP-seq
MIRT1105298	hsa-miR-770-5p	CLIP-seq
MIRT2029035	hsa-miR-194	CLIP-seq
MIRT1105236	hsa-miR-4511	CLIP-seq
MIRT1105238	hsa-miR-4645-3p	CLIP-seq
MIRT1105245	hsa-miR-4700-3p	CLIP-seq
MIRT1105254	hsa-miR-4759	CLIP-seq
MIRT1105281	hsa-miR-548b-3p	CLIP-seq
MIRT1105290	hsa-miR-570	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ZFP36	Repression	20335167

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	12853976
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000922	Component	Spindle pole	IBA
GO:0000922	Component	Spindle pole	IDA	12853976
GO:0000922	Component	Spindle pole	IEA
GO:0001827	Process	Inner cell mass cell fate commitment	IEA
GO:0001828	Process	Inner cell mass cellular morphogenesis	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10871863, 30865227, 35429439, 39173637
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16413547, 18158288, 19739119, 20303269, 24255178, 24682284, 25026211, 25438054, 27107012, 28514442, 30865227, 32707033, 33961781
GO:0005524	Function	ATP binding	IDA	10871863
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10673337
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	10673337
GO:0005737	Component	Cytoplasm	IDA	35429439
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA	30865227
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10871863
GO:0008104	Process	Intracellular protein localization	IEA
GO:0009755	Process	Hormone-mediated signaling pathway	IDA	15131260
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0017015	Process	Regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0030216	Process	Keratinocyte differentiation	IEA
GO:0034451	Component	Centriolar satellite	IDA
GO:0035329	Process	Hippo signaling	IBA
GO:0035329	Process	Hippo signaling	IDA	35429439
GO:0035329	Process	Hippo signaling	IDA	20412773, 35429439
GO:0035329	Process	Hippo signaling	IEA
GO:0035329	Process	Hippo signaling	IEA
GO:0035329	Process	Hippo signaling	TAS
GO:0035332	Process	Positive regulation of hippo signaling	IDA	11118213
GO:0035556	Process	Intracellular signal transduction	IDA	10871863
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0044772	Process	Mitotic cell cycle phase transition	IEA
GO:0045736	Process	Negative regulation of cyclin-dependent protein serine/threonine kinase activity	IDA	12853976
GO:0046620	Process	Regulation of organ growth	IBA
GO:0046620	Process	Regulation of organ growth	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051301	Process	Cell division	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IEA
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IMP	20412773
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	IEA
GO:1900181	Process	Negative regulation of protein localization to nucleus	ISS
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	39173637
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA

MIM	HGNC	e!Ensembl
604861	6515	ENSG00000150457

Q9NRM7

Protein name

Serine/threonine-protein kinase LATS2 (EC 2.7.11.1) (Kinase phosphorylated during mitosis protein) (Large tumor suppressor homolog 2) (Serine/threonine-protein kinase kpm) (Warts-like kinase)

Protein function

Negative regulator of YAP1 in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis (PubMed:18158288, PubMed:26437443, PubMed:26598551, PubMed:34404

PDB

4ZRI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	668 → 973	Protein kinase domain	Domain
PF00433	Pkinase_C	993 → 1042	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed at high levels in heart and skeletal muscle and at lower levels in all other tissues examined. {ECO:0000269|PubMed:10673337, ECO:0000269|PubMed:10871863}.

Sequence

MRPKTFPATTYSGNSRQRLQEIREGLKQPSKSSVQGLPAGPNSDTSLDAKVLGSKDATRQ
QQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRA
LKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSPGKGLMPTPVTRRPSFEGTGDSF
ASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVE
AAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGA
GLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLY
ELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPG
KAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPA
AEGLDAKEEHALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGM
EQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPY
AFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAKAGLCEAEQEQMRKILYQKESNYNRLKR
AKMDKSMFVKIKTLGIGAFGEVCLACKVDTHALYAMKTLRKKDVLNRNQVAHVKAERDIL
AEADNEWVVKLYYSFQDKDSLYFVMDYIPGGDMMSLLIRMEVFPEHLARFYIAELTLAIE
SVHKMGFIHRDIKPDNILIDLDGHIKLTDFGLCTGFRWTHNSKYYQKGSHVRQDSMEPSD
LWDDVSNCRCGDRLKTLEQRARKQHQRCLAHSLVGTPNYIAPEVLLRKGYTQLCDWWSVG
VILFEMLVGQPPFLAPTPTETQLKVINWENTLHIPAQVKLSPEARDLITKLCCSADHRLG
RNGADDLKAHPFFSAIDFSSDIRKQPAPYVPTISHPMDTSNFDPVDEESPWNDASEGSTK
AWDTLTSPNNKHPEHAFYEFTFRRFFDDNGYPFRCPKPSGAEASQAESSDLESSDLVDQT
EGCQPVYV

Sequence length

1088

Interactions

View interactions

	KEGG		Reactome
	Hippo signaling pathway Hippo signaling pathway - multiple species		Signaling by Hippo

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Malignant peritoneal mesothelioma	Likely pathogenic	rs1565941245	RCV000758177	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTROCYTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (115)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	24743869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24976335, 26908628, 31069869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	31275360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	31055025		★★★★★ ★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	30116813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior segment mesenchymal dysgenesis	Anterior segment mesenchymal dysgenesis	Pubtator	37239394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17049657, 31055025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	17297610, 26934863, 28991374, 30010037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17297610, 28387539, 32385107, 33247672, 34446703, 40684233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20932276, 26588988	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25973055, 28003305, 29183995, 32826865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28247446, 28815883, 30272278, 30481780, 30981110, 30999669, 32826865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30308519	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15265683, 24976335, 30551520, 31316723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	31820862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31586262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30993599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Cerebral Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	31055025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	30604274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22456107, 24360964, 24976283, 30037330, 31011291, 31119752, 31623173, 31646563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24360964, 34699318	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24976283, 31646563, 38273088	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30021349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30604274	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30485504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	19501585, 29145896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12370754, 19501585, 29145896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30852977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	27013235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrillary Astrocytoma	Fibrillary Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30282996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	25824045, 30116813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	31570771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gemistocytic astrocytoma	Gemistocytic Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26956052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30771084, 30896861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30896861	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31055025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Grade I Astrocytoma	Grade I Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	33670622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29183995	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	30604274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Astrocytoma	Intracranial Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	29378174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18565851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18565851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	24743869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22888524, 28247446, 29378174, 30272278, 30481780, 31097223, 31848340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15265683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20335167, 24976335, 31316723, 32361707, 33589592	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31069869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	30771084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	21245096, 21615608, 22286761, 24491449, 27773750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Mesothelioma of Peritoneum	Peritoneal mesothelioma	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15746036, 17297610, 26934863, 28991374, 30010037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30485504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	19501585, 20935475, 29145896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30282996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30923462, 30981110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15265683, 24976335, 30551520, 31316723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30046387, 31586262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15131260, 21278236, 27730751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19937137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15265683, 21278236, 24026096, 24360964, 25438054, 25482410, 26908628, 28247446, 31623173		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15746036, 25438054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	20421449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	25798586, 34531524, 37165917	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	25902174, 28003305, 29656754, 32083805, 34648949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30981110, 32554853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed oligoastrocytoma	Oligoastrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	20932276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	31004603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12370754, 15131260, 15265683, 15746036, 17049657, 17297610, 19008013, 19501585, 20237410, 20335167, 20841485, 20935475, 21245096, 21278236, 21852209 View all (25 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	26360373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	24336325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27013235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19008013, 19238334, 25391426, 26908628, 27470365, 28029651, 28434174, 28673012, 30314898, 30551520, 31646568		★★★★★ ★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	31055025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	31055025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29502343, 30551532, 31452740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	29502343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31586262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25179841, 31586262, 33576454, 37828220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	33670622	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	25798586, 30862609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30763910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15131260, 21278236, 27730751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15131260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15131260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34492128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Protoplasmic astrocytoma	Protoplasmic Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31772503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30021349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17604597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	30592270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	17538946, 20935475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28714002	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	25782587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	12370754, 29145896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32458634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19937137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	19937137, 26823784, 28214253, 32423384, 35728587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subependymal Giant Cell Astrocytoma	Astrocytoma	CTD_human_DG	17049657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweat Gland Neoplasms	Sweat gland neoplasm	Pubtator	33515627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	17711579	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28387539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	31055025		★★★★★ ★☆☆☆☆ Found in Text Mining only

LATS2 (large tumor suppressor kinase 2)