AGO1 (argonaute RISC component 1)

Gene

• Entrez ID: 26523
• Gene name: Argonaute RISC component 1
• Gene symbol: AGO1
• Synonyms (NCBI Gene): EIF2C, EIF2C1, GERP95, NEDLBAS, Q99, hAgo1
• Chromosome: 1
• Chromosome location: 1p34.3
• Summary: This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represse

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000649	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT019395	hsa-miR-148b-3p	Microarray	17612493
MIRT020233	hsa-miR-130b-3p	Sequencing	20371350
MIRT020459	hsa-miR-106b-5p	Microarray	17242205
MIRT028161	hsa-miR-93-5p	Sequencing	20371350
MIRT031191	hsa-miR-19b-3p	Sequencing	20371350
MIRT052451	hsa-let-7a-5p	CLASH	23622248
MIRT052451	hsa-let-7a-5p	CLASH	23622248
MIRT052100	hsa-let-7b-5p	CLASH	23622248
MIRT052100	hsa-let-7b-5p	CLASH	23622248
MIRT052100	hsa-let-7b-5p	CLASH	23622248
MIRT051847	hsa-let-7c-5p	CLASH	23622248
MIRT051847	hsa-let-7c-5p	CLASH	23622248
MIRT051424	hsa-let-7e-5p	CLASH	23622248
MIRT051424	hsa-let-7e-5p	CLASH	23622248
MIRT051424	hsa-let-7e-5p	CLASH	23622248
MIRT050855	hsa-miR-17-5p	CLASH	23622248
MIRT050855	hsa-miR-17-5p	CLASH	23622248
MIRT050855	hsa-miR-17-5p	CLASH	23622248
MIRT050855	hsa-miR-17-5p	CLASH	23622248
MIRT050491	hsa-miR-20a-5p	CLASH	23622248
MIRT050491	hsa-miR-20a-5p	CLASH	23622248
MIRT050491	hsa-miR-20a-5p	CLASH	23622248
MIRT050491	hsa-miR-20a-5p	CLASH	23622248
MIRT050491	hsa-miR-20a-5p	CLASH	23622248
MIRT050300	hsa-miR-25-3p	CLASH	23622248
MIRT050091	hsa-miR-26a-5p	CLASH	23622248
MIRT049967	hsa-miR-29a-3p	CLASH	23622248
MIRT049864	hsa-miR-31-5p	CLASH	23622248
MIRT049864	hsa-miR-31-5p	CLASH	23622248
MIRT049023	hsa-miR-92a-3p	CLASH	23622248
MIRT049023	hsa-miR-92a-3p	CLASH	23622248
MIRT049023	hsa-miR-92a-3p	CLASH	23622248
MIRT049023	hsa-miR-92a-3p	CLASH	23622248
MIRT049023	hsa-miR-92a-3p	CLASH	23622248
MIRT028161	hsa-miR-93-5p	CLASH	23622248
MIRT028161	hsa-miR-93-5p	CLASH	23622248
MIRT048678	hsa-miR-99a-5p	CLASH	23622248
MIRT048332	hsa-miR-106a-5p	CLASH	23622248
MIRT048053	hsa-miR-197-3p	CLASH	23622248
MIRT047934	hsa-miR-30c-5p	CLASH	23622248
MIRT047934	hsa-miR-30c-5p	CLASH	23622248
MIRT047786	hsa-miR-30d-5p	CLASH	23622248
MIRT047786	hsa-miR-30d-5p	CLASH	23622248
MIRT047389	hsa-miR-34a-5p	CLASH	23622248
MIRT047001	hsa-miR-212-3p	CLASH	23622248
MIRT046562	hsa-let-7g-5p	CLASH	23622248
MIRT045832	hsa-miR-138-5p	CLASH	23622248
MIRT045581	hsa-miR-149-5p	CLASH	23622248
MIRT045361	hsa-miR-185-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044946	hsa-miR-186-5p	CLASH	23622248
MIRT044876	hsa-miR-194-5p	CLASH	23622248
MIRT044872	hsa-miR-195-5p	CLASH	23622248
MIRT044422	hsa-miR-320a	CLASH	23622248
MIRT044422	hsa-miR-320a	CLASH	23622248
MIRT020459	hsa-miR-106b-5p	CLASH	23622248
MIRT020459	hsa-miR-106b-5p	CLASH	23622248
MIRT043875	hsa-miR-378a-3p	CLASH	23622248
MIRT043829	hsa-miR-330-3p	CLASH	23622248
MIRT043772	hsa-miR-328-3p	CLASH	23622248
MIRT043772	hsa-miR-328-3p	CLASH	23622248
MIRT043633	hsa-miR-326	CLASH	23622248
MIRT043039	hsa-miR-324-5p	CLASH	23622248
MIRT043039	hsa-miR-324-5p	CLASH	23622248
MIRT043039	hsa-miR-324-5p	CLASH	23622248
MIRT042472	hsa-miR-423-3p	CLASH	23622248
MIRT042384	hsa-miR-484	CLASH	23622248
MIRT041612	hsa-miR-146b-5p	CLASH	23622248
MIRT041207	hsa-miR-193b-3p	CLASH	23622248
MIRT041207	hsa-miR-193b-3p	CLASH	23622248
MIRT041207	hsa-miR-193b-3p	CLASH	23622248
MIRT041207	hsa-miR-193b-3p	CLASH	23622248
MIRT040923	hsa-miR-18a-3p	CLASH	23622248
MIRT040258	hsa-miR-615-3p	CLASH	23622248
MIRT039585	hsa-miR-628-3p	CLASH	23622248
MIRT039533	hsa-miR-652-3p	CLASH	23622248
MIRT039391	hsa-miR-421	CLASH	23622248
MIRT039094	hsa-miR-769-3p	CLASH	23622248
MIRT038746	hsa-miR-93-3p	CLASH	23622248
MIRT038746	hsa-miR-93-3p	CLASH	23622248
MIRT038199	hsa-miR-151a-5p	CLASH	23622248
MIRT037811	hsa-miR-455-3p	CLASH	23622248
MIRT037644	hsa-miR-744-5p	CLASH	23622248
MIRT037333	hsa-miR-877-5p	CLASH	23622248
MIRT036850	hsa-miR-877-3p	CLASH	23622248
MIRT036850	hsa-miR-877-3p	CLASH	23622248
MIRT036167	hsa-miR-320c	CLASH	23622248
MIRT052451	hsa-let-7a-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT052451	hsa-let-7a-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT052100	hsa-let-7b-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT051847	hsa-let-7c-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT437855	hsa-let-7d-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT051424	hsa-let-7e-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT437856	hsa-let-7f-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT046562	hsa-let-7g-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT437857	hsa-let-7i-5p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT249123	hsa-miR-103a-3p	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT026978	hsa-miR-107	Immunohistochemistry, Immunoprecipitaion, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23426184
MIRT438862	hsa-miR-1-3p	Luciferase reporter assay	23276603
MIRT438862	hsa-miR-1-3p	Luciferase reporter assay	23276603
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT640179	hsa-miR-6165	HITS-CLIP	23824327
MIRT640178	hsa-miR-4690-5p	HITS-CLIP	23824327
MIRT640177	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT640176	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT114120	hsa-miR-4779	HITS-CLIP	23824327
MIRT640174	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT640175	hsa-miR-3919	HITS-CLIP	23824327
MIRT640173	hsa-miR-4266	HITS-CLIP	23824327
MIRT609072	hsa-miR-218-5p	HITS-CLIP	24906430
MIRT609071	hsa-miR-219a-2-3p	HITS-CLIP	24906430
MIRT038746	hsa-miR-93-3p	HITS-CLIP	24906430
MIRT609070	hsa-miR-8075	HITS-CLIP	24906430
MIRT495731	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT495730	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT495729	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT495728	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT495727	hsa-miR-940	PAR-CLIP	22291592
MIRT495726	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT495725	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT495724	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT495723	hsa-miR-1324	PAR-CLIP	22291592
MIRT495721	hsa-miR-3166	PAR-CLIP	22291592
MIRT495731	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT495730	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT495729	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT495728	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT495727	hsa-miR-940	PAR-CLIP	22291592
MIRT495726	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT495725	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT495724	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT495723	hsa-miR-1324	PAR-CLIP	22291592
MIRT495722	hsa-miR-4756-3p	PAR-CLIP	22291592
MIRT495721	hsa-miR-3166	PAR-CLIP	22291592
MIRT114121	hsa-miR-2467-3p	PAR-CLIP	22291592
MIRT114113	hsa-miR-3678-3p	PAR-CLIP	22291592
MIRT445759	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445757	hsa-miR-4436b-3p	PAR-CLIP	22100165
MIRT445755	hsa-miR-4632-5p	PAR-CLIP	22100165
MIRT445756	hsa-miR-6735-5p	PAR-CLIP	22100165
MIRT445754	hsa-miR-6879-5p	PAR-CLIP	22100165
MIRT445753	hsa-miR-7843-5p	PAR-CLIP	22100165
MIRT039585	hsa-miR-628-3p	PAR-CLIP	22100165
MIRT445752	hsa-miR-325	PAR-CLIP	22100165
MIRT445751	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445750	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445749	hsa-miR-942-5p	PAR-CLIP	22100165
MIRT445748	hsa-miR-3616-3p	PAR-CLIP	22100165
MIRT445747	hsa-miR-4721	PAR-CLIP	22100165
MIRT445746	hsa-miR-4684-5p	PAR-CLIP	22100165
MIRT445745	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT445744	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT445742	hsa-miR-6734-5p	PAR-CLIP	22100165
MIRT020459	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050491	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT020459	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050855	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT137255	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT028161	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT137260	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT137249	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT031191	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT050491	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT495723	hsa-miR-1324	HITS-CLIP	27418678
MIRT495723	hsa-miR-1324	HITS-CLIP	27418678
MIRT495723	hsa-miR-1324	HITS-CLIP	27418678
MIRT495723	hsa-miR-1324	HITS-CLIP	27418678
MIRT495723	hsa-miR-1324	HITS-CLIP	27418678
MIRT495731	hsa-miR-1910-3p	HITS-CLIP	27418678
MIRT495731	hsa-miR-1910-3p	HITS-CLIP	27418678
MIRT495731	hsa-miR-1910-3p	HITS-CLIP	27418678
MIRT495731	hsa-miR-1910-3p	HITS-CLIP	27418678
MIRT495731	hsa-miR-1910-3p	HITS-CLIP	27418678
MIRT495726	hsa-miR-2682-5p	HITS-CLIP	27418678
MIRT495726	hsa-miR-2682-5p	HITS-CLIP	27418678
MIRT495726	hsa-miR-2682-5p	HITS-CLIP	27418678
MIRT495726	hsa-miR-2682-5p	HITS-CLIP	27418678
MIRT495726	hsa-miR-2682-5p	HITS-CLIP	27418678
MIRT495721	hsa-miR-3166	HITS-CLIP	27418678
MIRT495721	hsa-miR-3166	HITS-CLIP	27418678
MIRT495721	hsa-miR-3166	HITS-CLIP	27418678
MIRT495721	hsa-miR-3166	HITS-CLIP	27418678
MIRT495721	hsa-miR-3166	HITS-CLIP	27418678
MIRT495725	hsa-miR-34b-5p	HITS-CLIP	27418678
MIRT495725	hsa-miR-34b-5p	HITS-CLIP	27418678
MIRT495725	hsa-miR-34b-5p	HITS-CLIP	27418678
MIRT495725	hsa-miR-34b-5p	HITS-CLIP	27418678
MIRT495725	hsa-miR-34b-5p	HITS-CLIP	27418678
MIRT495724	hsa-miR-449c-5p	HITS-CLIP	27418678
MIRT495724	hsa-miR-449c-5p	HITS-CLIP	27418678
MIRT495724	hsa-miR-449c-5p	HITS-CLIP	27418678
MIRT495724	hsa-miR-449c-5p	HITS-CLIP	27418678
MIRT495724	hsa-miR-449c-5p	HITS-CLIP	27418678
MIRT495730	hsa-miR-6511a-5p	HITS-CLIP	27418678
MIRT495730	hsa-miR-6511a-5p	HITS-CLIP	27418678
MIRT495730	hsa-miR-6511a-5p	HITS-CLIP	27418678
MIRT495730	hsa-miR-6511a-5p	HITS-CLIP	27418678
MIRT495730	hsa-miR-6511a-5p	HITS-CLIP	27418678
MIRT495729	hsa-miR-6808-5p	HITS-CLIP	27418678
MIRT495729	hsa-miR-6808-5p	HITS-CLIP	27418678
MIRT495729	hsa-miR-6808-5p	HITS-CLIP	27418678
MIRT495729	hsa-miR-6808-5p	HITS-CLIP	27418678
MIRT495729	hsa-miR-6808-5p	HITS-CLIP	27418678
MIRT495728	hsa-miR-6893-5p	HITS-CLIP	27418678
MIRT495728	hsa-miR-6893-5p	HITS-CLIP	27418678
MIRT495728	hsa-miR-6893-5p	HITS-CLIP	27418678
MIRT495728	hsa-miR-6893-5p	HITS-CLIP	27418678
MIRT495728	hsa-miR-6893-5p	HITS-CLIP	27418678
MIRT495727	hsa-miR-940	HITS-CLIP	27418678
MIRT495727	hsa-miR-940	HITS-CLIP	27418678
MIRT495727	hsa-miR-940	HITS-CLIP	27418678
MIRT495727	hsa-miR-940	HITS-CLIP	27418678
MIRT495727	hsa-miR-940	HITS-CLIP	27418678
MIRT734881	hsa-miR-153-5p	Luciferase reporter assay, Western blotting	33414440
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT709903	hsa-miR-892b	HITS-CLIP	19536157
MIRT709902	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT709901	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT445749	hsa-miR-942-5p	HITS-CLIP	19536157
MIRT709900	hsa-miR-4777-3p	HITS-CLIP	19536157
MIRT709899	hsa-miR-4279	HITS-CLIP	19536157
MIRT709898	hsa-miR-6875-3p	HITS-CLIP	19536157
MIRT709897	hsa-miR-4659a-3p	HITS-CLIP	19536157
MIRT709896	hsa-miR-4659b-3p	HITS-CLIP	19536157
MIRT640179	hsa-miR-6165	HITS-CLIP	23824327
MIRT640178	hsa-miR-4690-5p	HITS-CLIP	23824327
MIRT640177	hsa-miR-6510-5p	HITS-CLIP	23824327
MIRT640176	hsa-miR-4695-5p	HITS-CLIP	23824327
MIRT114120	hsa-miR-4779	HITS-CLIP	23824327
MIRT640174	hsa-miR-4717-5p	HITS-CLIP	23824327
MIRT640175	hsa-miR-3919	HITS-CLIP	23824327
MIRT640173	hsa-miR-4266	HITS-CLIP	23824327
MIRT495731	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT495730	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT495729	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT495728	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT495727	hsa-miR-940	PAR-CLIP	22291592
MIRT495726	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT495725	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT495724	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT495723	hsa-miR-1324	PAR-CLIP	22291592
MIRT495721	hsa-miR-3166	PAR-CLIP	22291592
MIRT495731	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT495730	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT495729	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT495728	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT495727	hsa-miR-940	PAR-CLIP	22291592
MIRT495726	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT495725	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT495724	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT495723	hsa-miR-1324	PAR-CLIP	22291592
MIRT495722	hsa-miR-4756-3p	PAR-CLIP	22291592
MIRT495721	hsa-miR-3166	PAR-CLIP	22291592
MIRT114121	hsa-miR-2467-3p	PAR-CLIP	22291592
MIRT114113	hsa-miR-3678-3p	PAR-CLIP	22291592
MIRT445759	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT445757	hsa-miR-4436b-3p	PAR-CLIP	22100165
MIRT445755	hsa-miR-4632-5p	PAR-CLIP	22100165
MIRT445756	hsa-miR-6735-5p	PAR-CLIP	22100165
MIRT445754	hsa-miR-6879-5p	PAR-CLIP	22100165
MIRT445753	hsa-miR-7843-5p	PAR-CLIP	22100165
MIRT039585	hsa-miR-628-3p	PAR-CLIP	22100165
MIRT445752	hsa-miR-325	PAR-CLIP	22100165
MIRT445751	hsa-miR-517-5p	PAR-CLIP	22100165
MIRT445750	hsa-miR-1251-5p	PAR-CLIP	22100165
MIRT445749	hsa-miR-942-5p	PAR-CLIP	22100165
MIRT445748	hsa-miR-3616-3p	PAR-CLIP	22100165
MIRT445747	hsa-miR-4721	PAR-CLIP	22100165
MIRT445746	hsa-miR-4684-5p	PAR-CLIP	22100165
MIRT445745	hsa-miR-6834-5p	PAR-CLIP	22100165
MIRT445744	hsa-miR-1226-5p	PAR-CLIP	22100165
MIRT445742	hsa-miR-6734-5p	PAR-CLIP	22100165

Transcription factors

Transcription factor	Regulation	Reference
SOX4	Unknown	19147588

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IEA
GO:0000956	Process	Nuclear-transcribed mRNA catabolic process	IDA	18771919
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000993	Function	RNA polymerase II complex binding	IDA	25336585
GO:0001046	Function	Core promoter sequence-specific DNA binding	IMP	25336585
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IDA	23809764
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IDA	19966796
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0003727	Function	Single-stranded RNA binding	IDA	19966796
GO:0003727	Function	Single-stranded RNA binding	IEA
GO:0004521	Function	RNA endonuclease activity	IDA	23809764
GO:0005515	Function	Protein binding	IPI	12526743, 16289642, 16756390, 17891150, 17932509, 18482256, 19167051, 19324964, 19383768, 19716330, 20616046, 22484317, 22915799, 25036637, 25336585, 28330616, 28683311, 33961781, 35271311, 35709258
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	25336585
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	15260970, 17932509, 20014101
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0010586	Process	MiRNA metabolic process	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0016442	Component	RISC complex	IBA
GO:0016442	Component	RISC complex	IDA	15260970, 17932509, 19966796
GO:0016442	Component	RISC complex	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	23426184
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031054	Process	Pre-miRNA processing	IBA
GO:0031054	Process	Pre-miRNA processing	IDA	19966796
GO:0031054	Process	Pre-miRNA processing	IEA
GO:0035194	Process	Regulatory ncRNA-mediated post-transcriptional gene silencing	IBA
GO:0035196	Process	MiRNA processing	IMP	22795694
GO:0035198	Function	MiRNA binding	IBA
GO:0035198	Function	MiRNA binding	IDA	15260970
GO:0035198	Function	MiRNA binding	IEA
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IDA	18771919
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IEA
GO:0035279	Process	MiRNA-mediated gene silencing by mRNA destabilization	IDA	15260970
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IBA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IEA
GO:0043488	Process	Regulation of mRNA stability	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	25336585
GO:0070578	Component	RISC-loading complex	IDA	19966796
GO:0070578	Component	RISC-loading complex	IEA
GO:0070922	Process	RISC complex assembly	IDA	19966796
GO:0070922	Process	RISC complex assembly	IEA
GO:0090625	Process	SiRNA-mediated gene silencing by mRNA destabilization	IDA	15260970
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	IEA
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 606228
• HGNC: 3262
• e!Ensembl: ENSG00000092847

Protein

• UniProt ID: Q9UL18
• Protein name: Protein argonaute-1 (Argonaute1) (hAgo1) (Argonaute RISC catalytic component 1) (Eukaryotic translation initiation factor 2C 1) (eIF-2C 1) (eIF2C 1) (Putative RNA-binding protein Q99)
• Protein function: Required for RNA-mediated gene silencing (RNAi). Binds to short RNAs such as microRNAs (miRNAs) or short interfering RNAs (siRNAs), and represses the translation of mRNAs which are complementary to them. Lacks endonuclease activity and does not
• PDB: 1SI2, 1SI3, 4KRE, 4KRF, 4KXT, 5W6V
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16486	ArgoN	34 → 164	N-terminal domain of argonaute	Domain
  PF08699	ArgoL1	174 → 224	Argonaute linker 1 domain	Domain
  PF02170	PAZ	229 → 363	PAZ domain	Domain
  PF16488	ArgoL2	372 → 418	Argonaute linker 2 domain	Family
  PF16487	ArgoMid	427 → 509	Mid domain of argonaute	Domain
  PF02171	Piwi	515 → 816	Piwi domain	Family

• Sequence:

  MEAGPSGAAAGAYLPPLQQVFQAPRRPGIGTVGKPIKLLANYFEVDIPKIDVYHYEVDIK
  PDKCPRRVNREVVEYMVQHFKPQIFGDRKPVYDGKKNIYTVTALPIGNERVDFEVTIPGE
  GKDRIFKVSIKWLAIVSWRMLHEALVSGQIPVPLESVQALDVAMRHLASMRYTPVGRSFF
  SPPEGYYHPLGGGREVWFGFHQSVRPAMWKMMLNIDVSATAFYKAQPVIEFMCEVLDIRN
  IDEQPKPLTDSQRVRFTKEIKGLKVEVTHCGQMKRKYRVCNVTRRPASHQTFPLQLESGQ
  TVECTVAQYFKQKYNLQLKYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLTDNQTS
  TMIKATARSAPDRQEEISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGRVLPAPILQYGG
  RNRAIATPNQGVWDMRGKQFYNGIEIKVWAIACFAPQKQCREEVLKNFTDQLRKISKDAG
  MPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGM
  ATQCVQVKNVVKTSPQTLSNLCLKINVKLGGINNILVPHQRSAVFQQPVIFLGADVTHPP
  AGDGKKPSITAVVGSMDAHPSRYCATVRVQRPRQEIIEDLSYMVRELLIQFYKSTRFKPT
  RIIFYRDGVPEGQLPQILHYELLAIRDACIKLEKDYQPGITYIVVQKRHHTRLFCADKNE
  RIGKSGNIPAGTTVDTNITHPFEFDFYLCSHAGIQGTSRPSHYYVLWDDNRFTADELQIL
  TYQLCHTYVRCTRSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQAL
  AKAVQVHQDTLRTMYFA

• Sequence length: 857

Pathways

Reactome:

Pre-NOTCH Transcription and Translation
MicroRNA (miRNA) biogenesis
Oxidative Stress Induced Senescence
Oncogene Induced Senescence
Ca2+ pathway
Small interfering RNA (siRNA) biogenesis
Post-transcriptional silencing by small RNAs
Transcriptional regulation by small RNAs
TP53 Regulates Metabolic Genes
MAPK6/MAPK4 signaling
Transcriptional Regulation by VENTX
Regulation of RUNX1 Expression and Activity
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
Regulation of PTEN mRNA translation
Competing endogenous RNAs (ceRNAs) regulate PTEN translation
Transcriptional Regulation by MECP2
Estrogen-dependent gene expression
NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
AGO1-associated disorder	Pathogenic	rs1645271555	RCV001254059	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AGO1-related disorder	Likely pathogenic; Pathogenic	rs2148715376	RCV003416406	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
AGO1-related neurodevelopmental disorder	Likely pathogenic; Pathogenic	rs2148711383	RCV003147642	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual disability	Likely pathogenic; Pathogenic	rs2148715376, rs2148711374, rs1645264815, rs2148711383, rs2148725560, rs2148726029, rs1645271555	RCV001731166 RCV001837037 RCV001730185 RCV001730186 RCV001731183 RCV001731184 RCV001731153	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neurodevelopmental abnormality	Likely pathogenic	rs1645264815	RCV001264711	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder with language delay and behavioral abnormalities, with or without seizures	Likely pathogenic; Pathogenic	rs2148711374, rs1645264815, rs2148711383, rs2523869404, rs1553154069	RCV003155422 RCV003155423 RCV003155424 RCV004595137 RCV004760682 RCV003155383	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AGO1-related Intellectual disability	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental disorder	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizure	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Self-injurious behavior	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe global developmental delay	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe intellectual disability	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tremor	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28557556		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GENOMICS_ENGLAND_DG	29346770		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	34930816	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23696926, 30284063, 32812257	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22647351		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21319996, 29487329	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25656609, 29857476		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20721975, 27669275, 30858133		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23696926	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22647351		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32744319	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23939471		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31664087	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22694265		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	25271087, 34930816	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36990227	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	25271087, 29891360		★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	GENOMICS_ENGLAND_DG	29346770		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29256262		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	29256262	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	32400052	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	32400052	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	30627556	Associate	★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28634830		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30627556	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	29346770		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Mental retardation	BEFREE	30213762		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	34930816	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Language Development Disorders	Language development disorders	Pubtator	34930816	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	36142557	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21319996, 29487329		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27669275, 33832481	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23696926	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	25756049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20721975, 27669275, 30858133		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22647351		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22025453		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23426184, 26912082, 28555645, 29857476, 30858133		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23939471		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22694265		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	27221928		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20381449, 21846468, 23097274		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	21846468		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	21846468	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	22647351		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30627556	Associate	★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	30627556	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20924207	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	29256262	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25656609, 29857476	Associate	★☆☆☆☆ Found in Text Mining only