Gene Gene information from NCBI Gene database.
Entrez ID 26512
Gene name Integrator complex subunit 6
Gene symbol INTS6
Synonyms (NCBI Gene)
DBI-1DDX26DDX26ADICE1HDBINT6Notchl2
Chromosome 13
Chromosome location 13q14.3
Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. The protein encoded by this gene is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is inv
miRNA miRNA information provided by mirtarbase database.
240
miRTarBase ID miRNA Experiments Reference
MIRT020710 hsa-miR-155-5p Reporter assay;Other 20584899
MIRT023673 hsa-miR-1-3p Proteomics 18668040
MIRT028529 hsa-miR-30a-5p Proteomics 18668040
MIRT442153 hsa-miR-95-5p PAR-CLIP 22100165
MIRT442152 hsa-miR-4317 PAR-CLIP 22100165
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
24
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin IDA 34004147
GO:0004888 Function Transmembrane signaling receptor activity TAS 10467397
GO:0005515 Function Protein binding IPI 16239144
GO:0005634 Component Nucleus IDA 34004147, 39032490
GO:0005634 Component Nucleus IDA 23904267
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
604331 14879 ENSG00000102786
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UL03
Protein name Integrator complex subunit 6 (Int6) (DBI-1) (Protein deleted in cancer 1) (DICE1)
Protein function Component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:33243860, PubMed:34004147, PubMed:39504960). The integrator complex provides a
PDB 7BV7 , 7CUN , 7PKS , 7YCX , 8RBX , 8RBZ , 8RC4 , 8YJB
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13519 VWA_2 4 132 von Willebrand factor type A domain Domain
PF15300 INT_SG_DDX_CT_C 807 869 INTS6/SAGE1/DDX26B/CT45 C-terminus Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. {ECO:0000269|PubMed:10467397}.
Sequence
MPILLFLIDTSASMNQRSHLGTTYLDTAKGAVETFMKLRARDPASRGDRYMLVTFEEPPY
AIKAGWKENHATFMNELKNLQAEGLTTLGQSLRTAFDLLNLNRLVTGIDNYGQGRNPFFL
EPAIIITITDGS
KLTTTSGVQDELHLPLNSPLPGSELTKEPFRWDQRLFALVLRLPGTMS
VESEQLTGVPLDDSAITPMCEVTGGRSYSVCSPRMLNQCLESLVQKVQSGVVINFEKAGP
DPSPVEDGQPDISRPFGSQPWHSCHKLIYVRPNPKTGVPIGHWPVPESFWPDQNSPTLPP
RTSHPVVKFSCTDCEPMVIDKLPFDKYELEPSPLTQFILERKSPQTCWQVYVSNSAKYSE
LGHPFGYLKASTALNCVNLFVMPYNYPVLLPLLDDLFKVHKAKPTLKWRQSFESYLKTMP
PYYLGPLKKAVRMMGAPNLIADSMEYGLSYSVISYLKKLSQQAKIESDRVIGSVGKKVVQ
ETGIKVRSRSHGLSMAYRKDFQQLLQGISEDVPHRLLDLNMKEYTGFQVALLNKDLKPQT
FRNAYDIPRRNLLDHLTRMRSNLLKSTRRFLKGQDEDQVHSVPIAQMGNYQEYLKQVPSP
LRELDPDQPRRLHTFGNPFKLDKKGMMIDEADEFVAGPQNKHKRPGEPNMQGIPKRRRCM
SPLLRGRQQNPVVNNHIGGKGPPAPTTQAQPDLIKPLPLHKISETTNDSIIHDVVENHVA
DQLSSDITPNAMDTEFSASSPASLLERPTNHMEALGHDHLGTNDLTVGGFLENHEEPRDK
EQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMKEIRKPGRKYERIFTLLKHVQGS
LQTRLIFLQNVIKEASRFKKRMLIEQLEN
FLDEIHRRANQINHINSN
Sequence length 887
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RNA polymerase II transcribes snRNA genes
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Autism spectrum disorder Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
INTS6-related disorder Uncertain significance; Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 11115556
★☆☆☆☆
Found in Text Mining only
Adenoma of large intestine Colorectal adenoma BEFREE 11751426
★☆☆☆☆
Found in Text Mining only
Brain Ischemia Cerebral Ischemia BEFREE 17324924, 20713899, 22960363
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 11115556, 17187232, 17626637, 20453879, 22907435, 25499975, 27550454, 30165191, 9403073
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 10467397, 11115556
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 28899352 Inhibit
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic Neoplasms BEFREE 17385060
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 10360675, 35247917 Associate
★☆☆☆☆
Found in Text Mining only
Eclampsia Eclampsia BEFREE 29895936
★☆☆☆☆
Found in Text Mining only
Glioblastoma Glioblastoma BEFREE 24481065
★☆☆☆☆
Found in Text Mining only