PLEK2 (pleckstrin 2)

Gene

• Entrez ID: 26499
• Gene name: Pleckstrin 2
• Gene symbol: PLEK2
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q23.3-q24.1
• Summary: The protein encoded by this gene associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. The encoded protein then interacts with the actin cytoskeleton to induce cell spreading. In conjunction with complement compo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016423	hsa-miR-193b-3p	Microarray	20304954
MIRT021685	hsa-miR-138-5p	qRT-PCR	21770894
MIRT1240690	hsa-miR-183	CLIP-seq
MIRT1240691	hsa-miR-199a-5p	CLIP-seq
MIRT1240692	hsa-miR-199b-5p	CLIP-seq
MIRT1240693	hsa-miR-2054	CLIP-seq
MIRT1240694	hsa-miR-3065-5p	CLIP-seq
MIRT1240695	hsa-miR-3200-5p	CLIP-seq
MIRT1240696	hsa-miR-3622b-5p	CLIP-seq
MIRT1240697	hsa-miR-3915	CLIP-seq
MIRT1240698	hsa-miR-3928	CLIP-seq
MIRT1240699	hsa-miR-421	CLIP-seq
MIRT1240700	hsa-miR-4272	CLIP-seq
MIRT1240701	hsa-miR-4435	CLIP-seq
MIRT1240702	hsa-miR-4649-3p	CLIP-seq
MIRT1240703	hsa-miR-4680-5p	CLIP-seq
MIRT2070760	hsa-miR-1252	CLIP-seq
MIRT1240690	hsa-miR-183	CLIP-seq
MIRT1240693	hsa-miR-2054	CLIP-seq
MIRT2070761	hsa-miR-2110	CLIP-seq
MIRT1240695	hsa-miR-3200-5p	CLIP-seq
MIRT2070762	hsa-miR-4271	CLIP-seq
MIRT2070763	hsa-miR-4426	CLIP-seq
MIRT2070764	hsa-miR-4533	CLIP-seq
MIRT2070765	hsa-miR-4647	CLIP-seq
MIRT2070766	hsa-miR-4662b	CLIP-seq
MIRT2070767	hsa-miR-4699-5p	CLIP-seq
MIRT2070768	hsa-miR-4725-3p	CLIP-seq
MIRT2070769	hsa-miR-4747-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030036	Process	Actin cytoskeleton organization	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0031258	Component	Lamellipodium membrane	IEA
GO:0031346	Process	Positive regulation of cell projection organization	IEA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IEA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IEA
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IEA
GO:0120034	Process	Positive regulation of plasma membrane bounded cell projection assembly	IEA

Other IDs

• MIM: 608007
• HGNC: 19238
• e!Ensembl: ENSG00000100558

Protein

• UniProt ID: Q9NYT0
• Protein name: Pleckstrin-2
• Protein function: May help orchestrate cytoskeletal arrangement. Contribute to lamellipodia formation.
• PDB: 1X1G
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00169	PH	5 → 104	PH domain	Domain
  PF00610	DEP	142 → 223	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
  PF00169	PH	248 → 353	PH domain	Domain

• Sequence:

  MEDGVLKEGFLVKRGHIVHNWKARWFILRQNTLVYYKLEGGRRVTPPKGRILLDGCTITC
  PCLEYENRPLLIKLKTQTSTEYFLEACSREERDAWAFEITGAIHAGQPGKVQQLHSLRNS
  FKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEA
  VTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLS
  TVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSL
  VSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT

• Sequence length: 353

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27581786		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36928924	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33084541	Stimulate	★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	31182136		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29202466		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34676872	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31182136		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	30816427	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30816427		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35936006	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34331382	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37910672	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30626913		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31182136		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21698244		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21698244	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	32922167	Associate	★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29202466		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31182136		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31498891		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34331382	Associate	★☆☆☆☆ Found in Text Mining only