Gene Gene information from NCBI Gene database.
Entrez ID 2649
Gene name Nuclear receptor subfamily 6 group A member 1
Gene symbol NR6A1
Synonyms (NCBI Gene)
CT150GCNFGCNF1NR61RTRhGCNFhRTR
Chromosome 9
Chromosome location 9q33.3
Summary This gene encodes an orphan nuclear receptor which is a member of the nuclear hormone receptor family. Its expression pattern suggests that it may be involved in neurogenesis and germ cell development. The protein can homodimerize and bind DNA, but in viv
miRNA miRNA information provided by mirtarbase database.
138
miRTarBase ID miRNA Experiments Reference
MIRT016117 hsa-miR-421 Sequencing 20371350
MIRT021417 hsa-miR-9-5p Microarray 17612493
MIRT025188 hsa-miR-181a-5p Sequencing 20371350
MIRT025188 hsa-miR-181a-5p PAR-CLIP 21572407
MIRT542882 hsa-miR-181b-5p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
37
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IEA
GO:0000122 Process Negative regulation of transcription by RNA polymerase II ISS
GO:0000785 Component Chromatin IBA
GO:0000785 Component Chromatin ISA
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602778 7985 ENSG00000148200
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q15406
Protein name Nuclear receptor subfamily 6 group A member 1 (Germ cell nuclear factor) (GCNF) (hGCNF) (Retinoid receptor-related testis-specific receptor) (RTR) (hRTR)
Protein function Orphan nuclear receptor that binds to a response element containing the sequence 5'-TCAAGGTCA-3' (PubMed:26769970). Acts as a regulator of embryonic stem cell pluripotency by mediating repression of POU5F1/OCT4: binds to the DR0 element within t
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00105 zf-C4 58 127 Zinc finger, C4 type (two domains) Domain
PF00104 Hormone_recep 283 457 Ligand-binding domain of nuclear hormone receptor Domain
Tissue specificity TISSUE SPECIFICITY: Shows highest expression in the germ cells of the adult testis. {ECO:0000269|PubMed:8982251, ECO:0000269|PubMed:9134503, ECO:0000269|PubMed:9177477, ECO:0000269|PubMed:9493564, ECO:0000269|PubMed:9537518}.
Sequence
MERDEPPPSGGGGGGGSAGFLEPPAALPPPPRNGFCQDELAELDPGTISVSDDRAEQRTC
LICGDRATGLHYGIISCEGCKGFFKRSICNKRVYRCSRDKNCVMSRKQRNRCQYCRLLKC
LQMGMNR
KAIREDGMPGGRNKSIGPVQISEEEIERIMSGQEFEEEANHWSNHGDSDHSSP
GNRASESNQPSPGSTLSSSRSVELNGFMAFREQYMGMSVPPHYQYIPHLFSYSGHSPLLP
QQARSLDPQSYSLIHQLLSAEDLEPLGTPMLIEDGYAVTQAELFALLCRLADELLFRQIA
WIKKLPFFCELSIKDYTCLLSSTWQELILLSSLTVYSKQIFGELADVTAKYSPSDEELHR
FSDEGMEVIERLIYLYHKFHQLKVSNEEYACMKAINFLNQDIRGLTSASQLEQLNKRYWY
ICQDFTEYKYTHQPNRFPDLMMCLPEIRYIAGKMVNV
PLEQLPLLFKVVLHSCKTSVGKE
Sequence length 480
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation
Nuclear Receptor transcription pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
5
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Gastric cancer Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Arteriosclerosis Arteriosclerosis BEFREE 26546462
★☆☆☆☆
Found in Text Mining only
Atherosclerosis Atherosclerosis BEFREE 26546462
★☆☆☆☆
Found in Text Mining only
Cakut Congenital anomalies of the kidney and urinary tract Pubtator 40774958 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 33941198, 37903971 Associate
★☆☆☆☆
Found in Text Mining only
Choriocarcinoma Choriocarcinoma LHGDN 11969338
★☆☆☆☆
Found in Text Mining only
Diabetic Nephropathies Diabetic neuropathy Pubtator 38374020 Associate
★☆☆☆☆
Found in Text Mining only
Epithelioid hemangioendothelioma Epithelioid Hemangioendothelioma BEFREE 27334221
★☆☆☆☆
Found in Text Mining only
Familial lichen amyloidosis Lichen amyloidosis BEFREE 28969082
★☆☆☆☆
Found in Text Mining only
Leukemia Myeloid Acute Myeloid leukemia Pubtator 28222251, 35148810 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 23532770, 28969082
★☆☆☆☆
Found in Text Mining only