Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	26468
Gene name	LIM homeobox 6
Gene symbol	LHX6
Synonyms (NCBI Gene)	LHX6.1hLHX6
Chromosome	9
Chromosome location	9q33.2
Summary	This gene encodes a member of a large protein family that contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein has tandem LIM domains as well as a DNA-binding homeodomain. The protein functions as a transcription factor

Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016904	hsa-miR-335-5p	Microarray	18185580
MIRT028799	hsa-miR-26b-5p	Microarray	19088304
MIRT572716	hsa-miR-218-2-3p	PAR-CLIP	20371350
MIRT572715	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT572714	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT572712	hsa-miR-3919	PAR-CLIP	20371350
MIRT572713	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT572711	hsa-miR-5690	PAR-CLIP	20371350
MIRT572710	hsa-miR-1273f	PAR-CLIP	20371350
MIRT572709	hsa-miR-8069	PAR-CLIP	20371350
MIRT572708	hsa-miR-218-1-3p	PAR-CLIP	20371350
MIRT572716	hsa-miR-218-2-3p	PAR-CLIP	20371350
MIRT572715	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT572714	hsa-miR-506-5p	PAR-CLIP	20371350
MIRT572712	hsa-miR-3919	PAR-CLIP	20371350
MIRT572713	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT572711	hsa-miR-5690	PAR-CLIP	20371350
MIRT572710	hsa-miR-1273f	PAR-CLIP	20371350
MIRT572709	hsa-miR-8069	PAR-CLIP	20371350
MIRT572708	hsa-miR-218-1-3p	PAR-CLIP	20371350
MIRT755546	hsa-miR-1290	Luciferase reporter assayWestern blottingqRT-PCR	34729246
MIRT1109045	hsa-miR-1245b-5p	CLIP-seq
MIRT1109046	hsa-miR-1266	CLIP-seq
MIRT1109047	hsa-miR-1285	CLIP-seq
MIRT1109048	hsa-miR-1295	CLIP-seq
MIRT1109049	hsa-miR-1913	CLIP-seq
MIRT1109050	hsa-miR-3142	CLIP-seq
MIRT1109051	hsa-miR-3157-3p	CLIP-seq
MIRT1109052	hsa-miR-3187-5p	CLIP-seq
MIRT1109053	hsa-miR-324-3p	CLIP-seq
MIRT1109054	hsa-miR-3664-3p	CLIP-seq
MIRT1109055	hsa-miR-4492	CLIP-seq
MIRT1109056	hsa-miR-4498	CLIP-seq
MIRT1109057	hsa-miR-4505	CLIP-seq
MIRT1109058	hsa-miR-4518	CLIP-seq
MIRT1109059	hsa-miR-4757-5p	CLIP-seq
MIRT1109060	hsa-miR-612	CLIP-seq
MIRT1109061	hsa-miR-762	CLIP-seq
MIRT2030144	hsa-miR-1293	CLIP-seq
MIRT2030145	hsa-miR-3682-3p	CLIP-seq
MIRT2030146	hsa-miR-4483	CLIP-seq
MIRT2261028	hsa-miR-330-3p	CLIP-seq
MIRT2261029	hsa-miR-380	CLIP-seq
MIRT2261030	hsa-miR-4495	CLIP-seq
MIRT2261031	hsa-miR-488	CLIP-seq
MIRT2261032	hsa-miR-548m	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PITX2	Activation	23229549

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	10393337
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 32814053, 33961781, 35140242
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007399	Process	Nervous system development	IEA
GO:0021799	Process	Cerebral cortex radially oriented cell migration	ISS
GO:0021800	Process	Cerebral cortex tangential migration	ISS
GO:0021853	Process	Cerebral cortex GABAergic interneuron migration	ISS
GO:0021884	Process	Forebrain neuron development	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0030182	Process	Neuron differentiation	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048469	Process	Cell maturation	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
608215	21735	ENSG00000106852

Q9UPM6

Protein name

LIM/homeobox protein Lhx6 (LIM homeobox protein 6) (LIM/homeobox protein Lhx6.1)

Protein function

Probable transcription factor required for the expression of a subset of genes involved in interneurons migration and development. Functions in the specification of cortical interneuron subtypes and in the migration of GABAergic interneuron prec

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00412	LIM	70 → 127	LIM domain	Domain
PF00412	LIM	131 → 188	LIM domain	Domain
PF00046	Homeodomain	220 → 276	Homeodomain	Domain

Sequence

MAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGQASPCTPSTPSVCSPPSAAS
SVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCK
MDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVL
CRIHYDTMIENLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQ
DNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPPSRLPSALSDD
IHYTPFSSPERARMVTLHGYIESQVQCGQVHCRLPYTAPPVHLKADMDGPLSNRGEKVIL
FQY

Sequence length

363

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (26)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28900494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	23549991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30669148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	26129710, 29863252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29863252	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29863252, 33977077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16732332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24157876, 28900494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31810245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	31810245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	22435649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38563293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32857719	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	38563293	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	35240203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26129710, 29863252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24157876, 28900494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29863252, 31810245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24157876, 28900494, 29226322, 31151060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28396596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	22937123, 22983435, 25464914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22937123, 22983435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27328999	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	28900494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	24337411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	30389505, 35384355	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LHX6 (LIM homeobox 6)